Biochemicals and Reagents

Peptide Ac-KYSEEGDGPAQHAEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GENFTETDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FHTITTSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Conjugated THC-BSA hapten</p>

<p>Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FTISADTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Ala-Ala-Ala-pNA • HCl is a porcine pancreatic elastase inhibitor. It is a chromogenic substrate that inhibits the proteolytic activity of elastase by binding to the active site and blocking its access to the peptide bond. H-Ala-Ala-Ala-pNA • HCl is used as an enzyme inhibitor in biochemistry and molecular biology research, and has been shown to inhibit enzymatic activity of human leukocyte elastase. The peptide is also a substrate for astacin, which cleaves it at the Cys residue.</p>

<p>H-AEDTAVYYCAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AEDTAVYYCAR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AEDTAVYYCAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AEDTAVYYCAR-OH at the technical inquiry form on this page</p>

<p>14.3.3 Sigma antibody (BSA/Azide-free) was raised in mouse using recombinant human 14-3-3 sigma protein as the immunogen.</p>

<p>Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VIQELGLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>AL 3152 is a galactose-binding lectin that binds to the carbohydrate moiety of galactose and galactosamine. It is used as a marker for the detection of inflammatory cells in tissues. The pharmacokinetics of AL 3152 in Sprague Dawley rats have been studied using biochemical and histological methods. The elimination phase was found to be rapid, with only about one third of the drug being eliminated in urine and about two thirds being eliminated in bile.</p>

<p>Peptide H-RSLEINIDDQEQVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-SKSKDRKYTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lodoxamide is a type of ophthalmic medication known as a mast cell stabilizer, which is chemically synthesized from non-steroidal structures. It works by inhibiting the degranulation of sensitized mast cells and subsequent release of inflammatory mediators such as histamine. This action is achieved through the stabilization of the cell membrane of mast cells, thus preventing cellular activation.</p>

<p>Complement C3 is a fundamental factor featured in all three complement system pathways: the classical, lectin and alternative. To activate the complement cascade C3 associates with C3 convertase to produce C3a and C3b. It is also thought that C3 can be cleaved by proteases outside of the complement cascade. C3b can bind to carbohydrate and protein hydroxyl groups through a thioester bond generated by C3 convertase cleavage. This action allows C3b to be used as a 'marker of foreign molecules such as pathogens and ultimately leads to the assembly of the membrane attack complex (MAC) and anaphylatoxin production.Overall the main functions of the complement system are to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cell by the MAC. The anaphylatoxins C3a and C5a recruit neutrophils and causes the inflammatory response while the MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.</p>

<p>CA 15-3 antibody was raised in mouse using human CA 15-3 antigen from a human cell line as the immunogen.</p>

Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SSPAVEQQLLVSGPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prolactin antibody was raised in mouse using purified human prolactin as the immunogen.</p>

Peptide H-IGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EFSEVEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QPGITFIAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ATIMMQRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RGFFYTPKTRR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Apelin-17 (human, bovine) is derived from the apelin peptide which acts as a ligand for the apelin receptor (APJ) G protein coupled receptor and is a substrate for angiotensin converting enzyme 2. Preprapelin, encoded for by APLN located on Xq25-26.1, is cleaved to form either apelin 36,or apelin 17, 12 and apelin 13. As a member of the adipokine hormone family, which are involved in processes such as vascular homeostasis and angiogenesis, apelin is secreted from adipose tissue.Apelin has been found to be expressed in the spinal cord and the human brain and when performing immunohistochemistry it was observed that apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells.Both apelin and the apelin receptor are widely distributed around the body thus apelin has been found to be associated with cardiovascular diseases, obesity, diabetes and cancer. Studies exploring myocardial infarction showed there to be greater apelin mRNA expression during human heart failure compared to in healthy tissue. Apelin protects against heart failure due to, the pyroglutamyl form of apelin, playing a role in decreasing infarct size of myocardial infarctions. Furthermore in rats with hypertension, the expression of apelin and APJ was decreased.</p>

Peptide H-EGYYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-CRLVSDVFPSARDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-CYPYDVPDYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TFRRRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fibronectin Adhesion-Promoting Peptide is a polyclonal antibody that recognizes fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin promotes cell adhesion and proliferation by binding to collagen. This antibody can be used to detect fibronectin in tissues from patients with cancer. It may also be used as a tool for identifying cancer cells that have metastasized to other sites in the body.</p>

<p>Peptide H-VGNILQLGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-YKRWIILGLNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YKRWIILGLNK-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YKRWIILGLNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YKRWIILGLNK-OH at the technical inquiry form on this page</p>

<p>Lasioglossin-III (Lasio-III) is a naturally-occurring salt-resistant anti-microbial peptide (AMP) found in-Lasioglossum laticeps-(broad-faced furrow bee). Lasioglossin-III has broad spectrum anti-microbial activity and anti-biofilm properties against Gram negative and Gram positive bacteria, including strong anti-microbial activity against-E. coli,-S. aureus, and-P aeruginosa-under physiological salt concentration, with low toxicity.AMPs form an important part of the innate immune system in plants, animals and insects-and are reported to be effective even against several antibiotic resistant strains due to differing modes of pathogen killing from those of conventional antibiotics. Lasio-III has a membranolytic mode of action. It can bind both the outer and inner membranes of bacteria. Lasio-III possesses a fast killing ability toward both Gram positive and negative bacteria compared to many other active AMPs.</p>

<p>Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>PAMP-12 is a peptide that can activate the human immune system. It can be used as a research tool for studying protein interactions and receptor ligand pharmacology. PAMP-12 is an inhibitor of ion channels, which are proteins that regulate the flow of ions through cell membranes. The CAS number for this peptide is 196305-05-2.</p>

<p>H-AKFVAAWTLKAAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AKFVAAWTLKAAA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AKFVAAWTLKAAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AKFVAAWTLKAAA-OH at the technical inquiry form on this page</p>

<p>The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life &lt;-2 minutes) due to proteolytic degradation by the serine protease- dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use.In this peptide the phenylalanine residue at position 6 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1), the leucine residue at position 14 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1), and the leucine residue at position 26 is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (1). Additionally, the peptide contains an uncharged C-terminal amide.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Soluble amyloid-β (Aβ) oligomers are key to Alzheimer's disease (AD) pathology. Aβ oligomers constitute a significant component of senile plaques, and the presence of plaques is used to define AD.  Soluble Aβ is the most neurotoxic species- its presence correlates with AD onset and early progression. There is no current treatment to prevent the formation of neurotoxic Aβ oligomers. A proposed strategy to treat AD is the inhibition of Aβ oligomer interacting with the NMDA receptor. Disruption of NMDA receptor function and signalling molecules affect neuronal plasticity and development.Pep63 was identified via peptide array to block the interaction between Aβ oligomers and EphB2. Mouse AD model stereotactic administration of Pep63 into the dorsal hippocampus blocked the interaction between Aβ and EphB2, as shown by co-immunoprecipitation and Western blotting. Reduced Aβ presence was detected following Pep63 treatment seen by ELIZA. Pep63 effectively reverses impaired memory deficits determined by the Morris water maze (MWM) on the AD mouse model.</p>

<p>H-GLLLTRDGGNNNNGS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLLLTRDGGNNNNGS-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLLLTRDGGNNNNGS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLLLTRDGGNNNNGS-OH at the technical inquiry form on this page</p>

<p>Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. This penetratin has been synthesised with an N-terminal 6-azidohexanoic acid (Azhx) which can be used for various applications as a linker.</p>

<p>AFP antibody was raised in mouse using AFP from cord blood as the immunogen.</p>

<p>Morphine antibody was raised in mouse using morphine-3-BSA as the immunogen.</p>

<p>Recombinant Human Cardiac Troponin ITC-complex</p>

<p>Histone H3 (20-39)-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.</p>

<p>Antimicrobial and cytolytic peptide isolated from the venom of the spider wasp Anoplius samariensis. Anoplin has potent and board-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, antifungal properties against some plant pathogenic fungi, and no haemolytic activity against human erythrocytes. At 10 amino acids long, anoplin is the smallest naturally occurring antimicrobial and cytolytic peptide, its small size may have advantages for chemical manipulation and medical application.</p>

<p>Neisseria Gonorrhoeae Antibody is a monoclonal antibody known as trastuzumab that specifically targets Neisseria gonorrhoeae, the bacteria responsible for causing gonorrhea. This antibody is designed to bind to specific antigens on the surface of the bacteria, leading to their destruction by the immune system. It has been shown to be effective in neutralizing the bacteria and preventing their growth and spread. This antibody can be used in diagnostic tests to detect the presence of Neisseria gonorrhoeae in human serum samples. Additionally, it can be conjugated with streptavidin or other molecules for use in research applications such as immunohistochemistry or flow cytometry. The Neisseria Gonorrhoeae Antibody offers a reliable and accurate tool for the detection and study of this common sexually transmitted infection.</p>

<p>ANA Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

B-Raf (BRAF) is a raf-family serine/threonine kinase and proto-oncogene involved in directing cell growth. The Raf kinases are subject to a complex activation process that integrates various protein-protein and protein-lipid interactions and positive as well as negative phosphorylation events. The Ras/Raf/mitogen-activated/extracellular-regulated kinase (MEK)/extracellular signal regulated kinase (ERK) pathway plays a pivotal role in controlling proliferation, survival and differentiation of metazoan cells.

<p>Neurotensin 1 (NT1) receptor agonist</p>

<p>H-RHKSNITFNNNDTVSFGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RHKSNITFNNNDTVSFGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RHKSNITFNNNDTVSFGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RHKSNITFNNNDTVSFGGC-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IL^DTAGKEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Trp-OH is a trisubstituted, enantiomerically pure, excitatory amino acid. It has been shown to stimulate the release of neurotransmitters in the central nervous system and to have potent antitumor activity. Boc-D-Trp-OH is an unsaturated ketone that can be used as a building block for peptide synthesis. The disulfide bond present in this molecule may be reduced by the addition of DTT or DTE. This compound has also been shown to have cardiac hypertrophy inhibiting effects, due to its ability to inhibit PDE5 enzyme activity.</p>

<p>Peptide H-QIVQNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CMV antibody was raised in mouse using 65 kDa protein of cytomegalovirus as the immunogen.</p>

<p>Peptide H-DISLSDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Antagonist of dopamine (D2/D4), histamine and serotonin receptors</p>

<p>Peptide H-LNEVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Ac-SYSMEHARWGKPV-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SYSMEHARWGKPV-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SYSMEHARWGKPV-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SYSMEHARWGKPV-NH2 at the technical inquiry form on this page</p>

<p>Prolactin antibody was raised in mouse using human prolactin as the immunogen.</p>

<p>Peptide H-CQPLGMISLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pro-OBzl • Cl is a monoclonal antibody that binds to the active site of the ns3 protease, which is an enzyme that is involved in the processing of many proteins. Pro-OBzl • Cl has been shown to inhibit cancer cell growth and to reduce microbial infection by decreasing their ability to produce virulence factors. Pro-OBzl • Cl also has been shown to be effective against viruses such as hepatitis B virus. This drug binds to the receptor on the surface of cells and inhibits viral entry into cells.</p>

<p>Parainfluenza type 3 antibody was raised in mouse using hemagluttinin of parainfluenza virus, type 3 as the immunogen.</p>

<p>Annexin A5 (30-45) Heavy, derived from the annexin A5 protein is a member of the annexin family which is dependent on Ca2+ to bind reversibly to negatively charged phospholipids located on cell membranes. It has been shown that annexin A5 forms a two dimensional crystalline array when it binds to the membrane, allowing it to immobilise membrane proteins. This property allows annexin A5 to exhibit rupture-resealing activity. When the membrane becomes ruptured there is a large influx of Ca2+ ions into the cells, consequently annexin A5 binds to the ruptured area and the resealing of the area occurs due to the formation of annexin A5 two dimensional crystalline arrays.Annexin A5 can be used to image apoptosis through binding to the apoptotic marker Phosphatidylserine.The Arginine residue at position 9 has been isotopically labelled with carbon-13 (6) and nitrogen-15 (4), giving this peptide a mass increase of 16 compared to the unlabelled peptide.</p>

Peptide Biot-EKKYFAATQFEPLAARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-QESEVEEPL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AALEDTLAETEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TSH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the thyroid-stimulating hormone (TSH) receptor, blocking its interaction with TSH. This antibody can be used in various applications, including immunohistochemistry and ELISA assays, to study the role of TSH in different biological processes.</p>

<p>H-APETEPFLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-APETEPFLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-APETEPFLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-APETEPFLR-OH at the technical inquiry form on this page</p>

<p>CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DSGSPNPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-TESNKKFLPFQQFGRDIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLTSFLPAQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GAAQNIIPASTGAAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GAAQNIIPASTGAAK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GAAQNIIPASTGAAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GAAQNIIPASTGAAK-OH at the technical inquiry form on this page</p>

<p>Peptide H-MSKQQPTQFINPETPGYVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SFGWDLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTVISVNPSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibitor of FGFR kinase</p>

<p>Fmoc-Lys(Fmoc)-OH is an antibacterial agent that can be synthesized from a number of precursors. It has been shown to inhibit the uptake of mannose by staphylococcus cells and its subsequent use in the synthesis of bacterial cell walls. Fmoc-Lys(Fmoc)-OH also inhibits the growth of viruses, such as HIV, and human immunodeficiency virus type 1 (HIV-1), by binding to mannose receptors on the surface of macrophage-like cells. Intramolecular hydrogen bonds stabilise this complex, which prevents it from breaking down. This allows Fmoc-Lys(Fmoc)-OH to remain in the body for a longer period of time than other antibiotics that are broken down by enzymes. Fmoc-Lys(Fmoc)-OH has also been shown to be an effective antibacterial agent against Staphylococcus a</p>

Peptide H-IATEAIENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-NAVPITPTLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MVTAVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GFYYSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Fmoc-Asp(OtBu)-OH is a chemical compound that belongs to the group of modified amino acids. The synthesis of Fmoc-Asp(OtBu)-OH starts with the reaction of nicotinic acetylcholine, sodium carbonate, and chloride in trifluoroacetic acid. The product is then reacted with a disulfide bond and modified with polymerase chain and saponified. The final modification is achieved by reacting Fmoc-Asp(OtBu)-OH with messenger RNA (mRNA), which produces the desired product. Fmoc-Asp(OtBu)-OH has been shown to have minimal activity, as it does not elute from an ion exchange column under normal conditions. It also has no effect on acetylcholine release in rat hippocampal slices or on morphology when incubated in vitro for 24 hours at 37 degrees Celsius.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>H-Ala-Tyr-Pro-Gly-Lys-Phe-OH is a peptide that activates toll-like receptor 4 (TLR4). It is a potent inhibitor of the enzyme phospholipase A2 and has been shown to inhibit the production of proinflammatory cytokines, such as IL1β, IL6, IL8, and TNFα. This peptide also has anti-inflammatory effects on autoimmune diseases, such as rheumatoid arthritis. H-Ala-Tyr-Pro-Gly-Lys-Phe-OH has been shown to inhibit prostate cancer cell growth in vitro and in vivo. It appears to exert its action by interfering with the transcriptional process at the level of RNA polymerase II. The mechanism may involve inhibition of the activation of basic fibroblast cells or suppression of epidermal growth factor signaling. H-Ala-Tyr - Pro - Gly - Lys - Phe -</p>

JAK3tide is a synthetic peptide, which is a highly specific substrate. Derived from comprehensive biochemical studies, it targets the catalytic activity of the Janus kinase 3 (JAK3) enzyme. JAK3tide's mode of action involves being phosphorylated by JAK3, an essential kinase involved in the signaling pathways of certain cytokines, making it a vital tool for assaying JAK3 activity.When used in in vitro kinase assays, it enables precise quantification of JAK3's enzymatic activity, which is pivotal for understanding pathway dynamics involved in immune responses. Its application extends to research areas focused on elucidating the mechanisms of immune signaling pathways and for the development of inhibitors as potential therapeutic agents in immunological disorders. JAK3tide provides a robust framework for scientists aiming to dissect the nuanced interactions within the JAK-STAT pathway and identify novel therapeutic targets, particularly in conditions where JAK3 is dysregulated.

<p>Histone H3 (1-21) K4ac is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (1-21) lysine 4 has been acetylated.</p>

<p>Peptide H-NIDALSGMEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FYVQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DSSTSPGDYVL^SVSENSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>