Biochemicals and Reagents

<p>SAGE-217</p>

<p>DNaseMe</p>

<p>EasyPCR XY</p>

<p>UDGase</p>

<p>M100-500 DNA Ladder</p>

<p>T2 toxin triol</p>

<p>TaqNovaGC DNA Polymerase</p>

<p>3-Colour Prestained Protein Marker 10-180 kDa</p>

<p>Human Urokinase</p>

<p>Murashige and Skoog modified basal salts (? micros and ? macros)</p>

<p>M10kpz DNA Ladder ready-to-use</p>

<p>Murashige shoot tip rooting medium</p>

<p>Tyramine hydrochloride</p>

<p>Murashige and Skoog modified basal salts (? Nitrogen)</p>

<p>Azido-PEG4-Acrylate</p>

<p>EasyGenotyping PCR-RFLP S. aureus</p>

<p>3-Colour Prestained Protein Marker 10-245 kDa</p>

<p>TRANSCRIPTME M-MuLV Reverse Transcriptase</p>

<p>Bovine Serum Albumin Fraction V</p>

<p>Serazym® Bovine Serum Albumin 96 well plate</p>

<p>TRANSCRIPTME RNA Kit - cDNA synthesis kit</p>

<p>T4 DNA Ligase</p>

<p>Hydroxybupropion</p>

<p>IDEAL II DNA Ladder ready-to-use</p>

<p>M50pz DNA Ladder</p>

<p>Applications L-Citrulline-d7, is the labeled analogue of L-Citrulline (C535700), which is an amino acid, first isolated from the juice of watermelon, Citrullus vulgaris Schrad., Cucurbitaceae. It is also used in the treatment of asthenia.<br>References Kurtz, et al.: J. Biol. Chem., 122, 477 (1938), Rajantie, J., et al.: J. Pediatr., 97, 927 (1980), Carpenter, T.O., et al.: N. Engl. J. Med., 312, 290 (1985),<br></p>

<p>Stability Light Sensitive<br>Applications 6,7-Dimethyl-8-ribityllumazine serves as fluorophore in Lumazine (L473800) proteins (LumP) of luminescent bacteria.<br>References Kulinski, T., et al.: Biochemistry, 26, 540 (1987), Chatwell, L., et al.: J. Mol. Biol., 382, 44 (2008), Sancar, A., et al.: J. Biol. Chem., 283, 32153 (2008),<br></p>

<p>Applications Convallatoxin is a cardenolide that is used in the treatment of congestive heart failure. It may also be used in the treatment of tumor cells at nanomolar concentrations due to its anti-proliferative effects; in particular, human lung cancer. It is naturally found in the roots of Adonis Amurensis.<br> Not a dangerous good if item is equal to or less than 1g/ml and there is less than 100g/ml in the package<br>References Schneider, N., et al.: Nat. Prod. Res., (2015); Yin, L., et al.: Zhong Cao Yao, 45, 3361 (2014);<br></p>

<p>Applications 1,3-Distearoyl-2-oleoyl Glycerol is a triacid triglyceride found in cocoa butter and is used in the improvement of chocolate.<br>References Padley, F.B. et al.: Rev. Int. Choc., 27, 278 (1972);<br></p>

<p>Applications Monocaprylin is used in preparation of Citric Acid mixed grease plasticizer.Also, It is an active agent for skin and hair care with pysicochemistry modifying properties.<br>References Wang, M., et al.: Faming Zhuanli Shenqing, (2020); Kohlen, R., et al.: PCT Int. Appl., (2020);<br></p>

<p>Applications Verbascose (CAS# 546-62-3) is an α-galactooligosaccharide with immunomodulatory activity in mouse macrophage RAW264.7 cells.<br>References Dai, Z.; et al.: J. Agric. Food. Chem., 66, 9070 (2018);<br></p>

<p>Applications 2-Amino-6,8-dihydroxypurine is an 8-oxo-guanine repair pathway coordinated by MUTYH glycosylase and DNA polymerase λ.<br>References Avkin, S., et al.: Mutat. Res., 510, 81 (2002), Niimi, N., et al.: Biochem., 48, 4239 (2009), Muftuoglu, M., et al.: J. Biol. Chem., 284, 9270 (2009),<br></p>

<p>Stability Hygroscopic<br>Applications A nucleoside used in the synthesis of ribothymidine-3'-phosphate.<br></p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>SK channel blocker</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>Goat anti-rat IgG was raised in goat using highly pure rat IgG as the immunogen.</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Purified recombinant HIV2 RT ROD protein</p>

<p>HIV1 p24 antibody was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Properdin antibody</p>

<p>Furosemide antibody was raised in rabbit using furosemide-KLH as the immunogen.</p>

<p>Cortisol Saliva ELISA Kit</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Purified HIV1 protease IIIB protein</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Protected amino acid</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rabbit Polyclonal Phosphotyrosine antibody</p>

<p>Mouse monoclonal CD4 (T-cell receptor) antibody (FITC)</p>

<p>Sirt7 inhibitor 97491 is an anticancer drug that works by inhibiting the activity of Sirt7, a protein that promotes tumor growth. This inhibitor has been shown to be effective in human cancer cell lines and may have potential for use in cancer therapy. The drug has been tested in Chinese hamster ovary cells and was found to induce apoptosis, or programmed cell death, in these cells. Sirt7 inhibitor 97491 is an analog of chloroquine and can also inhibit kinases, which are enzymes involved in signaling pathways that regulate cell growth and division. In addition, this inhibitor has been found to increase the effectiveness of other anticancer drugs such as artesunate. Overall, Sirt7 inhibitor 97491 is a promising new drug candidate for the treatment of cancer.</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>Trypsin (EC 3.4.21.4) is a protease that hydrolyses proteins by cleaving the peptide bond at the carboxyl side of the positively charged amino acid (Lysine or Arginine). Trypsin belongs to a family of serine proteases, as it has a serine in its active site. Trypsin can be inhibited by using trypsin inhibitor Alpha 1 Antitrypsin.</p>

<p>Alpha-1 acid glycoprotein antibody was raised in goat using human alpha-1 acid glycoprotein as the immunogen.</p>

<p>THC antibody was raised in sheep using tetrahydrocannabinol-KLH as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant HIV1 Nef ELI (FITC)</p>

<p>The HIV1 tat protein is a Recombinant Protein &amp; Antigen that plays a crucial role in the epidermal growth factor signaling pathway. It is commonly used in Life Sciences research as a monoclonal antibody target, particularly in studies involving trastuzumab. The HIV1 tat protein has been found to interact with various proteins, including fibronectin, activated nuclear proteins (such as alpha-synuclein and c-myc), collagen, and endothelial growth factors. These interactions contribute to the regulation of cell growth, proliferation, and differentiation. Additionally, the HIV1 tat protein has shown potential as a therapeutic target for anti-HER2 antibody therapies due to its involvement in HER2-mediated signaling pathways.</p>

<p>AR-R 17779 is a selective agonist for α7 nicotinic acetylcholine receptors or nAChRs. It is suggested that AR-R 17779 reduces formation of atherosclerotic plaques and abdominal aortic aneurysms in apolipoprotein E-deficient mice.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Lipase protein is a crucial component in the breakdown of fats and plays a significant role in various biological processes. It acts as an enzyme that catalyzes the hydrolysis of triacylglycerols into fatty acids and glycerol. Lipase protein has been extensively studied for its involvement in adipose tissue metabolism, where it helps mobilize stored fats for energy production.</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Ketoconazole is a versatile powder that has neutralizing properties and can be used in various applications in the Life Sciences field. It is commonly used as a growth factor in Biological Reagents, where it promotes the growth and development of cells. Additionally, ketoconazole is known for its ability to interact with antibodies, including monoclonal antibodies and trifunctional antibodies, enhancing their effectiveness.</p>

<p>E. coli antibody was raised in mouse using E. coli shigatoxin as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Goat polyclonal HIV1 antibody</p>

<p>Bombesin antibody was raised in rabbit using Bombesin-BSA as the immunogen.</p>

<p>Goat polyclonal CRP antibody</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>ELISA kit for the detection of Cardiolipin IgG/IgM1 in the research laboratory</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>Purified recombinant HIV2 p26 ROD (FITC)</p>

<p>Goat polyclonal PF4 antibody</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Rabbit polyclonal anti-tat HIV1 antibody (Biotin)</p>

<p>Listeria Monocytogenes Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Listeria Monocytogenes Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rabbit anti Chicken IgY antibody</p>

<p>Progesterone 17-OH antibody was raised in rabbit using 17-OH-Progesterone-3-CMO-BSA as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>Purified recombinant HIV1 p17 protein</p>

<p>Purified recombinant HIV1 p24 protein (HRP)</p>

<p>Progesterone antibody was raised in rabbit using 17a-OH progesterone -3-CMO-BSA as the immunogen.</p>

<p>The CD4 protein is a glycoprotein that plays a crucial role in the immune system. It is primarily found on the surface of helper T cells, which are a type of white blood cell involved in coordinating immune responses. The CD4 protein acts as a receptor for the HIV virus, allowing it to enter and infect host cells.</p>

<p>Purified recombinant SIV mac251 gp28 (HRP)</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>Purified recombinant HIV2 gp105 ROD (biotin)</p>

<p>Purified recombinant HIV1 p24 HxB2 (biotin)</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>Goat polyclonal Digoxin antibody</p>

<p>Goat polyclonal Human Complement C4 antibody</p>

<p>Rabbit polyclonal CD4 (T-cell) antibody (FITC)</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Theophylline 8 antibody was raised in rabbit using theophylline-8 as the immunogen.</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goat anti Human IgE antibody</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>Epitestosterone antibody was raised in rabbit using protein-3-oxime-epitestosterone conjugate as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>

<p>Clonidine antibody was raised in rabbit using Clonidine-BSA as the immunogen.</p>

<p>Goat polyclonal cAMP antibody</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HIV1 gp41 antibody (HRP) was raised in mouse using purified, full length Recombinant gp41 (HIV-1) produced in E. coli expression system as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>Please enquire for more information about Cardiolipin IgA positive serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat anti Human IgA + IgD antibody</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>PLAC1 antibody was raised in rabbit using placenta specific antigen 1 (PLAC1) as the immunogen.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Vitamin A antibody was raised in rabbit using vitamin A as the immunogen.</p>

<p>TSH antibody was raised in goat using human TSH whole molecule as the immunogen.</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>Mouse monoclonal HIV1 integrase antibody (HRP)</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Please enquire for more information about Human Plasma Positive for Anti-HAV (IgM) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>Goat polyclonal Human Plasminogen antibody</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Triiodothyronine antibody was raised in rabbit using triiodothyronine (T3)-BSA as the immunogen.</p>

<p>Bradykinin antibody was raised in rabbit using bradykinin-BSA as the immunogen.</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>Polyclonal Red Blood Cell antibody</p>

<p>Mouse monoclonal HIV1 rev antibody (biotin); concentration 1.0 mg/ml</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>Guanidine thiocyanate is used as a chaotropic reagent in cell lysis buffers as it disrupts cell and organelle membranes. Guanidine thiocyanate is especially suitable for purification of nucleic acids from crude cell lysates as it is a protein denaturant, allowing for separation of nucleic acids from the protein fraction. Guanidine thiocyanate also inactivates DNAses and RNAses, giving favourable yields of nucleic acids.</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Rabbit polyclonal HIV2 gp105 antibody</p>

<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rabbit polyclonal BNP antibody</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Purified recombinant HIV1 tat HxB2 (FITC)</p>

<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>NT-proBNP Positive Human Li Heparin Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about NT-proBNP Positive Human Li Heparin Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about HAV IgM Positive Plasma, IMx PC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>Please enquire for more information about Alpha-Fetoprotein (AFP) Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>CMV p28 UL99 antibody was raised in mouse using cytomegalovirus minor capsid protein p28 as the immunogen.</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>HIV1-RT antibody (FITC) was raised in mouse using purified, full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>Theophylline antibody was raised in mouse using theophylline as the immunogen.</p>

<p>ELISA kit for the detection of dsDNA IgG in the research laboratory</p>

<p>Goat polyclonal FABP antibody</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>