Biochemicals and Reagents

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Purified recombinant HIV1 gp160 (HRP)</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Thyroxine antibody is a highly reactive collagen-based monoclonal antibody used in Life Sciences research. It is commonly used for the detection and quantification of thyroxine levels in human serum samples. This antibody specifically targets and binds to thyroxine, preventing its interaction with other molecules. The immobilization of this antibody on an electrode surface allows for efficient and sensitive detection of thyroxine levels. Additionally, studies have shown that this antibody has neutralizing effects on interleukin-6, a pro-inflammatory cytokine involved in various diseases. Furthermore, it has been observed that the binding of this antibody to thyroxine can inhibit the production of reactive oxygen species, making it potentially useful in antioxidant therapies.</p>

<p>Goat polyclonal Human  Complement 3D antibody</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Orientia Tsutsugamushi p56 Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Orientia Tsutsugamushi p56 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>CD4 antibody was raised in mouse using full length CD4 (T cell receptor) produced in baculovirus expression system as the immunogen.</p>

<p>hCG beta antibody was raised in goat using affinity purified hCG beta as the immunogen.</p>

<p>SLE IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SLE IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgE antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>PTH antibody was raised in goat using glandular PTH as the immunogen.</p>

<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in rabbit using LH beta-KLH as the immunogen.</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Measles virus nucleoprotein antibody was raised in goat using full length recombinant measles virus nucleoprotein produced in baculovirus expression system as the immunogen.</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>CD4 antibody was raised in rabbit using human T-Cell CD4 serum as the immunogen.</p>

<p>Nortestosterone antibody was raised in rabbit using 19-nortestosterone-17-KLH as the immunogen.</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>Please enquire for more information about H-DASSGVEAAAGLGESVAITH-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal CD4 (T-cell receptor) antibody (HRP)</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>Triiodothyronine antibody was raised in goat using triiodothyronine-BSA as the immunogen.</p>

<p>Tobramycin antibody was raised in goat using tobramycin-BSA as the immunogen.</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Rabbit Polyclonal HIV1 protease antibody</p>

<p>DHEA 7 Sulfate antibody was raised in rabbit using dehydroepiandrosterone-3-sulfate-7-oxime-BSA as the immunogen.</p>

<p>Troponin I antibody (cardiac) was raised in goat using human cardiac troponin I as the immunogen.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat anti Mouse IgG (H + L) secondary antibody (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication processes. Extensive research has demonstrated its efficacy using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>hCG antibody was raised in rabbit using hCG beta as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Mouse monoclonal HIV2 p26 antibody (biotin)</p>

<p>The Ebola Virus antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the glycoprotein found on the surface of the Ebola virus. This antibody has been extensively studied and proven to be effective in neutralizing the virus by inhibiting its entry into host cells.</p>

<p>FABP antibody was raised in goat using human fatty acid binding protein as the immunogen.</p>

<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Purified recombinant HIV1 p24 HxB2 (HRP)</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>Reactive orange 35 is a functional group that is used as an analytical reagent in organic solvents. It is also used to introduce additives into polymers, oligosaccharides, and other compounds. Reactive orange 35 has been shown to react with amide groups in the presence of an amine or ammonia at elevated temperatures. This reaction system can be used to produce a variety of compounds, including pharmaceuticals and pesticides. The reactive nature of this compound makes it an excellent plant cell penetrant.</p>

<p>FSH Beta antibody was raised in rabbit using FSH beta-KLH as the immunogen.</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The efficacy of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>Mouse monoclonal HIV1 integrase antibody (HRP)</p>

<p>HIV2 gp105 antibody was raised in rabbit using purified, full length recombinant gp105 (HIV-2 ROD) as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (FITC)</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>Testosterone-19 antibody was raised in rabbit using Testosterone-19-HSA as the immunogen.</p>

<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp26 antibody; immunogen full length recombinant p26 (HIV-2 ROD) produced in E.coli expression system</p>

<p>ELISA kit for detection of IFN Alpha in the research laboratory</p>

<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Dilantin antibody was raised in goat using phenytoin-BSA as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>The HIV1 Nef protein is a crucial component in the study of Life Sciences and has various applications in research and diagnostics. It is an antigen binding molecule that can be used in immunoassays and as a tool for studying receptor binding. The HIV1 Nef protein can be detected using colloidal or monoclonal antibodies, which specifically bind to this protein. These binding proteins are highly specific and can be used to detect the presence of the HIV1 Nef protein in samples.</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>FBP antibody was raised in rabbit using bovine milk as the immunogen.</p>

<p>HIV1 Nef antibody was raised in mouse using full length nef (HIV-1, ELI) as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Purified recombinant HIV1 Nef ELI (FITC)</p>

<p>Legionella Pneumophila LPS Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Legionella Pneumophila LPS Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>

<p>Purified recombinant SIV mac251 gp28 (HRP)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>Goat polyclonal Digoxin antibody</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Phenobarbital antibody was raised in goat using phenobarbitol-KLH as the immunogen.</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Purified recombinant HBsAg protein (Subtype adr)</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>HSV1 gC antibody was raised in mouse using herpes simplex virus gC-1 as the immunogen.</p>

<p>CKMM antibody was raised in goat using human skeletal muscle purified CK-MM Isoenzyme as the immunogen.</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>Rabbit polyclonal HIV1-RT antibody</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>Naproxen is a non-steroidal anti-inflammatory drug that has been used in the treatment of osteoarthritis, rheumatoid arthritis, ankylosing spondylitis, and gout. Naproxen sodium is the sodium salt of naproxen. It is a non-steroidal anti-inflammatory agent that inhibits the activity of cyclooxygenase (COX) enzymes. The rate constant for this reaction was determined by measuring the disappearance of COX enzyme from calf thymus DNA and bacterial DNA. This process is inhibited by naproxen sodium in vitro, which leads to less COX enzyme synthesis. Naproxen sodium also inhibits inflammation by inhibiting prostaglandin synthesis as well as promoting blood clotting by inhibiting platelet aggregation.</p>

<p>Rabbit polyclonal Cystatin C antibody</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>A chimeric human/macaque IgG1 anti-CD4 monoclonal antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Purified recombinant HIV1 tat HxB2 (HRP)</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>Polyclonal Red Blood Cell antibody</p>

<p>Cortisol Saliva ELISA Kit</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>HIV1 tat antibody (FITC) was raised in mouse using purified, full length Recombinant tat (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>Primidone antibody was raised in goat using primidoen-KLH as the immunogen.</p>

<p>Progesterone 11 antibody was raised in rabbit using Progesterone-11-HSA as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Mouse monoclonal REV (HIV-1 HxB2, HxB3) antibody (FITC)</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV2 p26 antibody (HRP)</p>

<p>Purified recombinant HIV2 RT ROD protein</p>

<p>Part Purified Human Prostatic Specific Antigen (PSA) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Part Purified Human Prostatic Specific Antigen (PSA) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Mouse monoclonal HIV1 Nef N-terminal antibody (biotin)</p>

<p>Salmonella Typhi IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Salmonella Typhi IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Purified recombinant HIV1-RT protein</p>

<p>Mouse monoclonal CD8 antibody (HRP)</p>

<p>Please enquire for more information about Glucagon Hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>M13K07 (delta) helper phage for use in phage display technology</p>

<p>HIV1 Nef antibody was raised in mouse using full length recombinant nef (HIV-1) as the immunogen.</p>

<p>Goat anti-guinea pig IgG was raised in goat using highly pure normal guinea pig serum as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp105 antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Polyclonal SIV mac251 gp28 antibody (biotin)</p>

<p>Rabbit polyclonal CD4 (T-cell) antibody (FITC)</p>

<p>The HRP2 antibody is an immobilized monoclonal antibody used in Life Sciences. It is specifically designed to target interferon-gamma (IFN-gamma), a cytokine involved in immune response regulation. This antibody can be used for various applications, including the detection and quantification of IFN-gamma in biological samples. Additionally, the HRP2 antibody has been shown to bind to virus surface antigens, insulin-like growth factors, fatty acids, and hormone peptides. Its high specificity and affinity make it a valuable tool in research and diagnostics. Furthermore, this antibody has also been demonstrated to be effective against alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. With its versatility and wide range of applications, the HRP2 antibody is an essential component for any laboratory working in the field of immunology and molecular biology.</p>

<p>Substance P antibody was raised in rabbit using substance P-BSA as the immunogen.</p>

<p>Testosterone antibody was raised in rabbit using testosterone-3 BSA as the immunogen.</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Goat anti Human IgA + IgD antibody</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Purified recombinant HIV2 gp36 ROD (FITC)</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Purified recombinant HIV2 gp36 ROD (HRP)</p>

<p>Goat polyclonal Globulin antibody</p>

<p>THC antibody was raised in rabbit using D8-THC-KLH as the immunogen.</p>

<p>Purified recombinant HIV1 p24 protein (HRP)</p>

<p>Plasminogen antibody was raised in goat using plasminogen isolated from normal human Plasma as the immunogen.</p>

<p>HIV1 rev antibody (FITC) was raised in rabbit using full length recombinant rev (HIV-1, HxB2, HxB3) produced in E. coli expression system as the immunogen.</p>

<p>ELISA kit for the detection of Cardiolipin IgG/IgM1 in the research laboratory</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.</p>

<p>Estradiol-3 antibody was raised in rabbit using 17 beta Estradiol-3-BSA as the immunogen.</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>Rabbit polyclonal SIV mac251 gp120 antibody (FITC); full SIV1 mac251 gp120 immunogen</p>

<p>Please enquire for more information about Cardiolipin IgA positive serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>Please enquire for more information about Human Plasma Positive for Anti-HAV (IgM) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>The ST2 antibody is a powerful tool in the field of Life Sciences. It specifically targets the IL-1 receptor and its binding proteins, making it an essential component in various experiments and research studies. The ST2 antibody is produced by a hybridoma cell line and has been extensively characterized for its specificity and potency.<br><br>One of the key applications of the ST2 antibody is its use as a neutralizing agent for interleukin (IL) signaling pathways. By blocking the interaction between IL-1 receptor and its ligands, the ST2 antibody effectively inhibits downstream signaling events, providing valuable insights into cellular responses mediated by IL-1.<br><br>Moreover, the ST2 antibody has been shown to have a high affinity for histone H1, a protein involved in chromatin structure and gene regulation. This interaction suggests that the ST2 antibody may play a role in modulating chromatin dynamics and epigenetic processes.<br><br>In addition to its research applications, the ST2 antibody can also be used as a</p>

<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>

<p>Purified recombinant HIV1 p24 HxB2 (biotin)</p>

<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>

<p>Purified recombinant HIV2 p26 ROD (FITC)</p>