Biochemicals and Reagents

<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>

<p>Rabbit polyclonal HIV-1 Rev antibody</p>

<p>Mouse monoclonal HIV1-RT antibody (biotin)</p>

<p>Borrelia burgdorferi antibody was raised in sheep using lyme disease (Borrelia Burdorferi) as the immunogen.</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>HIV1 p17 antibody (HRP) was raised in goat using recombinant p17 (HIV-1) produced in E. coli as the immunogen.</p>

<p>cGMP antibody was raised in rabbit using cGMP-BSA as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV) produced in baculovirus as the immunogen.</p>

<p>Orosomucoid antibody was raised in rabbit using rat alpha-1 acid glycoprotein as the immunogen.</p>

<p>CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.</p>

<p>Helicobacter pylori antibody is a molecular docking protein used in Life Sciences. It specifically targets the Helicobacter bacteria, which is known to cause various gastrointestinal diseases. This antibody has been extensively studied and proven to have a high affinity for H. pylori antigens, making it an effective tool for research and diagnostic purposes. Additionally, it has been shown to inhibit the chemokine production by H. pylori, thereby reducing inflammation caused by the bacteria. The antibody can be immobilized on surfaces such as ferritin or glycopeptide for use in assays or diagnostic tests. Monoclonal Antibodies with specific glycosylation patterns are available, allowing researchers to target different epitopes of the bacteria. Furthermore, this antibody has shown potential as a therapeutic agent against H. pylori infections by inhibiting its growth factor TGF-beta and phosphatase activity. Overall, Helicobacter pylori antibody is a valuable tool in the fight against H. pylori-related diseases</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>HIV1-RT antibody was raised in rabbit using full length recombinant RT (HIV-1) as the immunogen.</p>

<p>Purified recombinant HIV1 gp160 (HRP)</p>

<p>Purified recombinant HIV1 p17 protein</p>

<p>hCG beta antibody was raised in goat using affinity purified hCG beta as the immunogen.</p>

<p>Digoxin antibody was raised in rabbit using digoxin-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (HRP)</p>

<p>M13K07 (delta) helper phage for use in phage display technology</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Purified recombinant HBsAg protein (Subtype adr)</p>

<p>Inhibitor of PARP1 and PARP2 enzymes</p>

<p>Naproxen is a non-steroidal anti-inflammatory drug that has been used in the treatment of osteoarthritis, rheumatoid arthritis, ankylosing spondylitis, and gout. Naproxen sodium is the sodium salt of naproxen. It is a non-steroidal anti-inflammatory agent that inhibits the activity of cyclooxygenase (COX) enzymes. The rate constant for this reaction was determined by measuring the disappearance of COX enzyme from calf thymus DNA and bacterial DNA. This process is inhibited by naproxen sodium in vitro, which leads to less COX enzyme synthesis. Naproxen sodium also inhibits inflammation by inhibiting prostaglandin synthesis as well as promoting blood clotting by inhibiting platelet aggregation.</p>

<p>Please enquire for more information about H-DASSGVEAAAGLGESVAITH-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant HIV2 gp36 ROD (HRP)</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant HTLV1 gp21 (HRP)</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about Glucagon Hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Fetoprotein (AFP) Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sirt7 inhibitor 97491 is an anticancer drug that works by inhibiting the activity of Sirt7, a protein that promotes tumor growth. This inhibitor has been shown to be effective in human cancer cell lines and may have potential for use in cancer therapy. The drug has been tested in Chinese hamster ovary cells and was found to induce apoptosis, or programmed cell death, in these cells. Sirt7 inhibitor 97491 is an analog of chloroquine and can also inhibit kinases, which are enzymes involved in signaling pathways that regulate cell growth and division. In addition, this inhibitor has been found to increase the effectiveness of other anticancer drugs such as artesunate. Overall, Sirt7 inhibitor 97491 is a promising new drug candidate for the treatment of cancer.</p>

<p>Anti-Human CGRP Monoclonal Antibody</p>

<p>Purified recombinant HIV1 p24 protein (HRP)</p>

<p>Trypsin (EC 3.4.21.4) is a protease that hydrolyses proteins by cleaving the peptide bond at the carboxyl side of the positively charged amino acid (Lysine or Arginine). Trypsin belongs to a family of serine proteases, as it has a serine in its active site. Trypsin can be inhibited by using trypsin inhibitor Alpha 1 Antitrypsin.</p>

<p>Human IgG protein is a purified immunoglobulin that plays a crucial role in the immune system. It is widely used in life sciences research and various industrial applications. Human IgG protein has been extensively studied through molecular modeling, revealing its complex structure and functions.</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LKM-1 Antibody Positive Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Humanized anti-CD19 IgG1 monoclonal antibody</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>Legionella Pneumophila LPS Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Legionella Pneumophila LPS Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgM antibody</p>

<p>A chimeric human/macaque IgG1 anti-CD4 monoclonal antibody</p>

<p>Goat polyclonal FABP antibody</p>

<p>Goat polyclonal Human BNP antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.<br><br>Tilmicosin is a macrolide antibiotic primarily used in veterinary medicine for the treatment of respiratory disorders caused by</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>Goat polyclonal Human Ferritin antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>NT-proBNP Positive Human Li Heparin Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about NT-proBNP Positive Human Li Heparin Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Plasminogen antibody</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Goat anti Human IgG Fc + IgD antibody</p>

<p>Goat anti Human IgA antibody</p>

<p>Goat polyclonal FABP antibody</p>

<p>Goat polyclonal CRP antibody</p>

<p>Myoglobin antibody was raised in goat using human heart myoglobin as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Goat polyclonal Properdin antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat polyclonal Human alpha 2 Macroglobulin antibody</p>

<p>Goat polyclonal anti Human lambda light chain antibody</p>

<p>Goat polyclonal FABP antibody</p>

<p>Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Leishmania Infantum K39-LinJ Chimeric Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgM + IgD antibody</p>

<p>Goat polyclonal Human Complement C3 antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Rabbit polyclonal cAMP antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Rabbit polyclonal Human Hemoglobin A1c antibody</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Polyclonal Lipoprotein a antibody</p>

<p>Goat polyclonal cAMP antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Listeria Monocytogenes Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Listeria Monocytogenes Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>CRP antibody was raised in Goat using C-Reactive Protein purified from normal human Plasma/Serum as the immunogen.</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Goat polyclonal Human Gc Globulin antibody</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a synthetic peptide that binds to the integrin receptor on pancreatic cancer cells. It has been shown to be an effective diagnostic tool for pancreatic cancer and other cancers, such as prostate, breast, and lung. Cyclo(Arg-Gly-Asp-D-Phe-Lys) selectively binds to cells with high levels of integrin receptors by using "a heterofunctional approach." This technique is used in the synthesis of peptides because it increases the stability of peptides. Cyclo(Arg-Gly-Asp-D-Phe-Lys) can be used for diagnosis or therapeutic purposes.</p>

<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SHGQDYLVGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>SK channel blocker</p>

<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cortisol 3 antibody was raised in mouse using cortisol-3-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp120 protein (biotin)</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Mouse monoclonal CD8 antibody (biotin)</p>

<p>hCG antibody was raised in goat using hCG affinity purified as the immunogen.</p>

<p>Mouse monoclonal CD8 antibody (HRP)</p>

<p>Haloperidol antibody was raised in rabbit using haloperidol-KLH as the immunogen.</p>

<p>PTH antibody was raised in rabbit using hPTH as the immunogen.</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>Purified recombinant TPO protein (His tag)</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>Filamentous Hemagglutinin purified from Bordetella Pertussis</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Dilantin antibody was raised in goat using phenytoin-BSA as the immunogen.</p>

<p>FSH antibody was raised in mouse using highly purified FSH as the immunogen.</p>

<p>Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>Mouse monoclonal SIV mac251 gp120 antibody (HRP)</p>

<p>Rabbit polyclonal HIV2 p26 antibody</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>PTH antibody was raised in rabbit using bovine PTH whole molecule as the immunogen.</p>

<p>Mouse monoclonal CD4 (T-cell receptor) antibody (HRP)</p>

<p>Thyroxine antibody was raised in rabbit using thyroxine-BSA as the immunogen.</p>

<p>Ketoconazole is a versatile powder that has neutralizing properties and can be used in various applications in the Life Sciences field. It is commonly used as a growth factor in Biological Reagents, where it promotes the growth and development of cells. Additionally, ketoconazole is known for its ability to interact with antibodies, including monoclonal antibodies and trifunctional antibodies, enhancing their effectiveness.</p>

<p>Mouse monoclonal HIV1 Nef C-terminal antibody (biotin)</p>

<p>ApoA-I antibody was raised in mouse using human high density lipoprotein as the immunogen.</p>

<p>Purified recombinant HIV2 RT ROD protein</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>HIV1 p24 antibody (FITC) was raised in mouse using purified, full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>Digoxin antibody was raised in goat using digoxin-BSA as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>Mouse monoclonal CD4 antibody (biotin); IgG1; 50 ug/vial; clone 45</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Gentamicin antibody was raised in rabbit using gentamycin-KLH as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>HSV1 gE antibody was raised in mouse using herpes simplex virus I glycoprotein E (gE) as the immunogen.</p>

<p>AFP antibody was raised in rabbit using human AFP as the immunogen.</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>Troponin T antibody was raised in mouse using human cardiac troponin T as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Through extensive research using the patch-clamp technique on human erythrocytes, it has been proven to have a high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.<br><br>Tilmicosin is a macrolide antibiotic widely used in veterinary medicine to treat</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>Purified recombinant HTLV1 gp21 protein</p>

<p>Intrinsic Factor antibody was raised in rabbit using intrinsic factor as the immunogen.</p>

<p>HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>CD4 antibody was raised in mouse using full length recombinant CD4 (T cell) produced in baculovirus expression system as the immunogen.</p>

<p>HIV1 p24 antibody (biotin) was raised in mouse using purified full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Purified HIV1 protease IIIB protein</p>

<p>The HIV1 tat protein is a Recombinant Protein &amp; Antigen that plays a crucial role in the epidermal growth factor signaling pathway. It is commonly used in Life Sciences research as a monoclonal antibody target, particularly in studies involving trastuzumab. The HIV1 tat protein has been found to interact with various proteins, including fibronectin, activated nuclear proteins (such as alpha-synuclein and c-myc), collagen, and endothelial growth factors. These interactions contribute to the regulation of cell growth, proliferation, and differentiation. Additionally, the HIV1 tat protein has shown potential as a therapeutic target for anti-HER2 antibody therapies due to its involvement in HER2-mediated signaling pathways.</p>

<p>Estriol 6 antibody was raised in rabbit using estriol-6-BSA as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication processes. Extensive research has demonstrated its efficacy using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Luteinizing hormone antibody was raised in goat using human pituitary LH as the immunogen.</p>

<p>Rabbit polyclonal HIV2 gp105 antibody</p>

<p>HIV1 tat antibody was raised in mouse using full length recombinant tat (HIV-1) as the immunogen.</p>

<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVYHLGLPFSFLTFPYVEEAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Dilantin antibody was raised in rabbit using phenytoin-BSA as the immunogen.</p>

<p>Lipase protein is a crucial component in the breakdown of fats and plays a significant role in various biological processes. It acts as an enzyme that catalyzes the hydrolysis of triacylglycerols into fatty acids and glycerol. Lipase protein has been extensively studied for its involvement in adipose tissue metabolism, where it helps mobilize stored fats for energy production.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CRP antibody was raised in mouse using highly pure immuno grade C-RP as the immunogen.</p>

<p>Sheep anti-rabbit IgG was raised in sheep using highly pure rabbit IgG as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); immunogen recombinant gp41; IgG1; Supplied in lyophilized form in PBS buffer</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>Purified recombinant HIV2 gp36 ROD (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has shown its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RINSAKDDAAGLQIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

<p>Please enquire for more information about Elafibranor including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease. TFA salt; 95%.</p>

<p>Peptide H-MRWQEMGYIFYPRKLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>