Biochemicals and Reagents

<p>Peptide Ac-RQARRNRRRRWRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DLTDYLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cardiolipin/Beta-2-glycoprotein-1 IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cardiolipin/Beta-2-glycoprotein-1 IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Fluvastatin is a statin that lowers blood cholesterol and triglycerides by inhibiting HMG-CoA reductase, an enzyme that plays a critical role in the synthesis of cholesterol. Fluvastatin has also been shown to reduce the incidence of myocardial infarction, and to reduce atherosclerotic lesions in animal models, reducing the incidence of cardiovascular disease. Fluvastatin also has been shown to inhibit the activation of toll-like receptor 4 (TLR4) by lipopolysaccharide (LPS), which may be related to its anti-inflammatory effects. Furthermore, through lowering blood cholesterol, Fluvastatin also inhibits tubulointerstitial injury and prevents renal damage caused by high concentrations of the lipid.</p>

<p>Peptide H-AAVPSGASTGIYEALELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-TKDNNLLGRFELSGC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-TKDNNLLGRFELSGC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-TKDNNLLGRFELSGC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-TKDNNLLGRFELSGC-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-ELLETVV^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVFGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Normal Rabbit Serum is a versatile product that contains a variety of growth factors, chemokines, and antibodies. It is commonly used in life sciences research, veterinary applications, and other fields.</p>

<p>Darifenacin is a muscarinic antagonist that is used for the treatment of urinary incontinence. It specifically blocks the M3 muscarinic acetylcholine receptor which in return reduces the urgency to urinate.</p>

<p>Peptide H-GFVEPDHYVVVGAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Goxalapladib is a recombinant protein that stimulates homologous recombination, which is the repair of double-stranded DNA breaks. It is a particle that encompasses a recombinant adenoviral vector and a DNA sequence encoding for a gene targeted to the host cell chromosome. Goxalapladib has shown to be effective in treating heart diseases and cardiovascular diseases by reducing stenosis caused by coronary artery disease.</p>

<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Influenza B Virus Positive Human Nasal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza B Virus Positive Human Nasal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HSV-1/2 Antibody Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV-1/2 Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rubella Virus IgG Medium Titer Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Rubella Virus IgG Medium Titer Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HEV IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HEV IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Normal Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Normal Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>EBV VCA IgG/IgM Negative Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV VCA IgG/IgM Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>MPO Antibody Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about MPO Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HSV-1 IgG/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV-1 IgG/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Influenza B Virus Positive Human Nasopharyngeal Swab (UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza B Virus Positive Human Nasopharyngeal Swab (UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-SDVYCEVCEFLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-YSPWTNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-AETDKLEDEKSGLQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AETDKLEDEKSGLQR-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AETDKLEDEKSGLQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AETDKLEDEKSGLQR-OH at the technical inquiry form on this page</p>

<p>Gemcitabine is as a synthetic pyrimidine nucleoside prodrug. The hydrogen atoms on the 2' carbon of deoxycytidine are replaced by fluorine atoms. Gemcitabine works by being incorporated into the DNA of cancer cells during replication and inhibiting DNA synthesis. First gemcitabine is converted into its active form, gemcitabine triphosphate, by cellular enzymes including deoxycytidine kinase (DCK), after it is taken up by cancer cells. The gemcitabine triphosphate interferes with the normal functioning of the enzymes involved in replicating DNA, leading to the termination of DNA synthesis and ultimately, cell death. Gemcitabine is used as a chemotherapy drug used to treat various types of cancer, including pancreatic, lung, breast, and ovarian cancer.</p>

<p>H-WMVLPWLPGTLDGGSGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WMVLPWLPGTLDGGSGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WMVLPWLPGTLDGGSGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WMVLPWLPGTLDGGSGC-OH at the technical inquiry form on this page</p>

<p>HBeAg antibody was raised in mouse using recombinant HBeAg as the immunogen.</p>

<p>Peptide H-ALDFAVSEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Prealbumin antibody was raised in goat using purified human prealbumin as the immunogen.</p>

<p>Minocycline HCL (USP grade powder) chemical reference substance</p>

<p>Peptide H-VYNVTYTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CPF^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis elementary bodies as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>M13 phage antibody (FITC) was raised in mouse using fd phages from E.Coli F+ strain as the immunogen.</p>

<p>Prohibitin antibody (biotin) was raised in mouse using purified recombinant rat prohibitin protein as the immunogen.</p>

<p>Peptide H-DAVQATKPDMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LEEQSDQWKC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LEEQSDQWKC-OH is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LEEQSDQWKC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LEEQSDQWKC-OH at the technical inquiry form on this page</p>

<p>Peptide H-ATGVLYDYV^NK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-RLIEDNEYTAREGAK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RLIEDNEYTAREGAK-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RLIEDNEYTAREGAK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RLIEDNEYTAREGAK-NH2 at the technical inquiry form on this page</p>

<p>H-FMDVYQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FMDVYQR-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FMDVYQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FMDVYQR-OH at the technical inquiry form on this page</p>

<p>Inhibitor of GSK3 kinase; activator of Wnt signalling</p>

<p>Ac-SPELQRTPLHKSTTC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SPELQRTPLHKSTTC-NH2 is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SPELQRTPLHKSTTC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SPELQRTPLHKSTTC-NH2 at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-QITVNDLPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-TEHQAVLAEQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TEHQAVLAEQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TEHQAVLAEQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TEHQAVLAEQK-OH at the technical inquiry form on this page</p>