Biochemicals and Reagents

BMP2 antibody was raised in rabbit using highly pure human recombinant human BMP-2 as the immunogen.

CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

The Anti-CDV antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the antigen nuclear sclerostin, which is involved in bone metabolism. This antibody has been extensively studied and has shown high affinity for its target. It can be used in various research applications, including immunohistochemistry, flow cytometry, and Western blotting. The Anti-CDV antibody has also been explored as a potential therapeutic agent due to its cytotoxic properties. In addition, it can be conjugated with drugs to create antibody-drug conjugates for targeted therapy. Researchers and scientists rely on this monoclonal antibody to study and understand the role of sclerostin in bone health and disease progression.

MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA

MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV

TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

UNC84B antibody was raised using a synthetic peptide corresponding to a region with amino acids CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG

PSA antibody was raised in Mouse using human PSA as the immunogen.

SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS

IL6 antibody is a monoclonal antibody that specifically targets and neutralizes interleukin-6 (IL-6), a glycoprotein involved in various inflammatory processes. IL-6 plays a crucial role in the immune response by promoting the production of acute-phase proteins, regulating lymphocyte differentiation, and stimulating the growth of B cells. This activated antibody binds to IL-6 and prevents its interaction with its receptors, thereby inhibiting downstream signaling pathways. By blocking IL-6 activity, this antibody helps reduce inflammation and modulate immune responses. It has been extensively used in life sciences research to study the effects of IL-6 on various cellular processes, including collagen synthesis, cytotoxicity, epidermal growth factor signaling, actin filament organization, and fibrinogen production. With its high specificity and neutralizing abilities, the IL6 antibody is a valuable tool for investigating the role of IL-6 in both normal physiological processes and pathological conditions associated with excessive inflammation.

A synthetic peptide for use as a blocking control in assays to test for specificity of ADD2 antibody, catalog no. 70R-2193

TTR antibody is a monoclonal antibody that targets the antigen TTR (transthyretin). It acts as an inhibitor, preventing the activation of TTR and its subsequent effects. This antibody has been extensively studied in various assays, including those using human hepatocytes and microsomes. It has shown promising results in inhibiting the growth factor associated with TTR activity. Additionally, TTR antibody can be used in combination with other antibodies, such as polyclonal antibodies or interferon, to enhance its therapeutic effects. Its specificity for tyrosine residues makes it a valuable tool for research and diagnostic purposes.

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

EHBP1 antibody was raised in Rabbit using Human EHBP1 as the immunogen

The CD33 antibody is a monoclonal antibody that specifically targets and neutralizes autoantibodies. It works by binding to the arginase enzyme, inhibiting its activity and preventing the production of harmful metabolites. The CD33 antibody contains disulfide bonds that ensure its stability and effectiveness. It has a high affinity for serum albumin, which allows for efficient distribution throughout the body. This antibody can also bind to cellulose, cations, actin filaments, glutamate, and fatty acids, further enhancing its versatility. The CD33 antibody is commonly used in research and clinical settings to study autoimmune diseases and develop therapeutic interventions. Its effectiveness has been demonstrated in human serum samples, making it a valuable tool in biomedical research.