Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,750 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,826 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,896 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD105 antibody
CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.
Purity:Min. 95%ABHD2 antibody
ABHD2 antibody was raised using the middle region of ABHD2 corresponding to a region with amino acids RESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRCrystallin Beta B3 antibody
Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGLOC202759 antibody
LOC202759 antibody was raised in rabbit using the middle region of LOC202759 as the immunogenPurity:Min. 95%NT5M antibody
NT5M antibody was raised using the N terminal of NT5M corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLChicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.Purity:Min. 95%TUPLE1 antibody
TUPLE1 antibody was raised in mouse using recombinant H.Sapiens Tup1-Like Enhancer Of Split Gene 1 (Tuple1)ZBTB38 antibody
ZBTB38 antibody was raised in rabbit using the N terminal of ZBTB38 as the immunogenPurity:Min. 95%HSPB8 antibody
HSPB8 antibody was raised using the middle region of HSPB8 corresponding to a region with amino acids PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
NSD1 antibody
NSD1 antibody was raised in mouse using recombinant Human Nuclear Receptor Binding Set Domain Protein 1 (Nsd1)CLEC4M antibody
CLEC4M antibody was raised in rabbit using the middle region of CLEC4M as the immunogenPurity:Min. 95%DHFR antibody
The DHFR antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used to detect and study antiphospholipid antibodies, which are associated with various autoimmune disorders such as heparin-induced thrombocytopenia. The DHFR antibody can also be used to investigate the role of interferon and caffeine in cellular processes.Aquaporin 10 antibody
Aquaporin 10 antibody was raised using the middle region of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKPurity:Min. 95%
