Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,685 products)
- By Biological Target(100,178 products)
- By Pharmacological Effects(6,846 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(355 products)
- Plant Biology(6,912 products)
- Secondary Metabolites(14,361 products)
Found 130270 products of "Biochemicals and Reagents"
CNPase antibody
The CNPase antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to CNPase, a protein involved in myelination. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and ELISA assays. It has been shown to effectively detect CNPase in human serum and tissues, making it a valuable tool for studying the role of this protein in various biological processes. Additionally, the CNPase antibody has been demonstrated to have high specificity and sensitivity, ensuring accurate and reliable results. With its ability to recognize and bind to CNPase with high affinity, this antibody is an essential tool for researchers in the field of neuroscience and neurobiology.
Purity:Min. 95%ALAS2 antibody
ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNLONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids IGISRFRVLSHRHRDGYNTADIEYLEDEKVEGPEYEELAALHDSVHQQSVPurity:Min. 95%SRF antibody
The SRF antibody is a polyclonal antibody that targets the Serum Response Factor (SRF). SRF is a transcription factor that plays a crucial role in regulating gene expression, particularly in response to various stimuli such as interleukin-6, cholinergic signaling, and interferon. This antibody is widely used in life sciences research to study the function and regulation of SRF.Gpt protein
Gpt protein is a versatile binding protein that plays a crucial role in the Life Sciences field. It is widely used in various applications such as biomass analysis, hybridization studies, and protein-protein interactions. Gpt protein has the ability to bind to specific target molecules, including annexin, inhibitors, emission factors, viscosity modifiers, osteopontin, neutralizing antibodies, growth factors, and interferons. Its unique properties make it an essential tool for researchers working on Proteins and Antigens. With its high affinity and specificity, Gpt protein enables accurate detection and quantification of target molecules in biological samples. Whether you are conducting research or developing diagnostic assays, Gpt protein is an indispensable component that ensures reliable results.Purity:Min. 95%KLRA1 antibody
KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLPurity:Min. 95%MVK antibody
MVK antibody was raised using the N terminal of MVK corresponding to a region with amino acids LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAAFZD2 antibody
FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI
Purity:Min. 95%PPP1CA antibody
PPP1CA antibody was raised using the N terminal of PPP1CA corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCSLC25A38 antibody
SLC25A38 antibody was raised using the middle region of SLC25A38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRPurity:Min. 95%PIM1 antibody
PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
ST3GAL1 antibody
ST3GAL1 antibody was raised using the C terminal of ST3GAL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWENPurity:Min. 95%
