Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Synaptophysin antibody
Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGEPurity:Min. 95%PTX3 antibody
The PTX3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It has been shown to be highly effective in various applications, including chromatin immunoprecipitation assays and nuclear extracts. This antibody specifically targets PTX3, a protein that is activated in granulosa cells and plays a crucial role in the regulation of peptide hormones. The PTX3 antibody has also been used in cortical cultures and primary neuron cultures to study synaptic proteins and mitogen-activated protein signaling pathways. With its high specificity and reliability, this antibody is an essential tool for researchers looking to investigate the intricate mechanisms of cellular processes.USP7 antibody
The USP7 antibody is a highly specialized antibody that plays a crucial role in regulating fas-mediated apoptosis. It is widely used in the field of Life Sciences for various assays and research purposes. This monoclonal antibody specifically targets and inhibits the activity of USP7, which is an enzyme involved in the regulation of protein stability and cellular processes.Desmoplakin 1 + 2 antibody
Desmoplakin 1/2 antibody was raised in mouse using bovine desmoplakin 1 and 2 as the immunogen.GPR18 antibody
GPR18 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%TKTL2 antibody
TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAWHNRPK antibody
HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGSH2B3 antibody
The SH2B3 antibody is a monoclonal antibody that specifically targets the SH2B3 protein. This protein plays a crucial role in regulating various biological processes, including growth factor signaling, iron homeostasis, and cytoskeletal structure. The SH2B3 antibody has been extensively tested and validated for its specificity and effectiveness in detecting the SH2B3 protein in human serum samples.Influenza A antibody (H1N1)
Influenza A antibody (H1N1) was raised in goat using influenza A, strain USSR (H1N1) as the immunogen.Purity:Min. 95%p300 antibody
The p300 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the p300 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied for its cytotoxic effects on cancer cells and its potential as an anti-VEGF (vascular endothelial growth factor) therapy.ATC0175
CAS:ATC0175 is a synthetic analog of the natural fatty acid, gamma-aminobutyric acid (GABA). It has been shown to bind to GABA receptors in the brain and has potent antagonistic activity. ATC0175 inhibits serotonergic system and may be effective as a treatment for metabolic disorders, such as insulin resistance. In addition, this chemical compound may be beneficial for skin conditions such as psoriasis or eczema. ATC0175 is also synergistic with insulin in reducing food intake and body weight.Formula:C23H26ClF2N5OPurity:Min. 95%Molecular weight:461.94 g/mol
