Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cyclin E1 antibody
Human synthetic cyclin E1 immunogen, Rabbit polyclonal Cyclin E1 antibody, cross-reactive to mouse, rat
Annexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPC22ORF30 antibody
C22ORF30 antibody was raised using the middle region of C22Orf30 corresponding to a region with amino acids DELDGVKAACPCPQSSPPEQKEAEPEKRPKKVSQIRIRKTIPRPDPNLTPHNRPL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPL antibody, catalog no. 70R-1329Purity:Min. 95%Goat anti Rat IgG (H + L)
Goat anti-rat IgG (H+L) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%GALM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALM antibody, catalog no. 70R-4149Purity:Min. 95%CMV antibody (FITC)
CMV antibody (FITC) was raised in goat using purified virions of strain AD169 as the immunogen.RPUSD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPUSD2 antibody, catalog no. 70R-1460Purity:Min. 95%NOS3 antibody
The NOS3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the NOS3 protein, also known as endothelial nitric oxide synthase. This antibody is widely used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.FAM121B antibody
FAM121B antibody was raised using the N terminal Of Fam121B corresponding to a region with amino acids PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLGoat anti Human IgA (alpha chain) (FITC)
Goat anti-Human IgA (alpha chain) (FITC) was raised in goat using purified Human IgA as the immunogen.Purity:Min. 95%Nfkbiz Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Nfkbiz antibody, catalog no. 70R-9519Purity:Min. 95%
