Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,084 products)
- By Biological Target(99,070 products)
- By Pharmacological Effects(6,784 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,693 products)
- Secondary Metabolites(14,217 products)
Found 130573 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HIV1 Nef protein
<p>The HIV1 Nef protein is a vital component in the field of Life Sciences. It is a serine protease inhibitor that plays a crucial role in neutralizing the effects of HIV1. This Recombinant Protein & Antigen forms dimers and has been extensively studied for its potential therapeutic applications. Researchers have found that it exhibits inhibitory effects on the replication of HIV1, making it a promising target for drug development.</p>Purity:>95% By Sds-PageC20ORF100 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20ORF100 antibody, catalog no. 70R-7817</p>CYP4B1 antibody
<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>Purity:Min. 95%LYVE1 antibody
<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>Purity:Min. 95%LDH antibody
<p>LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.</p>Purity:Min. 95%STAT6 antibody
<p>The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>S100 antibody
<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>ACOT11 antibody
<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE</p>Purity:Min. 95%
