Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,750 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,826 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,896 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
OAS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OAS2 antibody, catalog no. 70R-5885Purity:Min. 95%Pfkfb2 antibody
Pfkfb2 antibody was raised in rabbit using the C terminal of Pfkfb2 as the immunogenPurity:Min. 95%RPS14 antibody
RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRLSPATA2L antibody
SPATA2L antibody was raised using the middle region of SPATA2L corresponding to a region with amino acids SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLECholic acid antibody
The Cholic Acid Antibody is a highly specialized product in the field of Life Sciences. It is an activated antibody that targets and neutralizes the effects of cholic acid, a potent growth factor involved in various biological processes. This antibody has been extensively studied and proven to be effective against multidrug resistance and autoantibodies associated with certain diseases.CETP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CETP antibody, catalog no. 70R-5415Purity:Min. 95%ApoBEC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC1 antibody, catalog no. 70R-4736Purity:Min. 95%MCM7 antibody
MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV
RPS7 antibody
RPS7 antibody was raised using the middle region of RPS7 corresponding to a region with amino acids RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF
