Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,703 products)
- By Biological Target(100,230 products)
- By Pharmacological Effects(6,834 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(357 products)
- Plant Biology(6,896 products)
- Secondary Metabolites(14,347 products)
Found 130153 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rabbit anti Goat IgG (biotin)
Rabbit anti-goat IgG (biotin) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). This receptor is activated by various growth factors and plays a crucial role in cell proliferation and differentiation. The EGFR antibody acts as a neutralizing agent, inhibiting the binding of growth factors to the receptor and preventing downstream signaling pathways.
Purity:Min. 95%Rabbit anti Chicken IgG (FITC)
Rabbit anti-chicken IgG (FITC) was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%GGA3 antibody
GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
Goat anti Rat IgG (Fab'2)
Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%CD49f antibody
The CD49f antibody is a specific antibody that targets fibronectin, a protein involved in cell adhesion and migration. This monoclonal antibody has been extensively used in various assays to study the role of fibronectin in different biological processes. It has been shown to inhibit the binding of fibronectin to its receptors, thereby preventing cell attachment and migration on fibronectin-coated surfaces. Additionally, the CD49f antibody has neutralizing activity against tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine involved in various inflammatory diseases. This antibody can be used in research and diagnostic applications to investigate the role of fibronectin and TNF-α in disease pathogenesis and as a potential therapeutic target.Caspase 12 antibody
The Caspase 12 antibody is a highly effective monoclonal antibody that acts as an inhibitor for caspase 12. It belongs to the family of chemokine antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically targets caspase 12, which is involved in various cellular processes such as apoptosis and inflammation. By inhibiting caspase 12, this antibody prevents its activation and subsequent downstream signaling events.FRK antibody
The FRK antibody is a monoclonal antibody that is used in the field of life sciences. It is designed to specifically target and neutralize the FRK protein, which plays a role in various cellular processes such as cell growth and differentiation. The FRK antibody has been shown to inhibit the activity of the FRK protein, making it a valuable tool for researchers studying its function. Additionally, this antibody can be used in hybridization experiments to detect the presence of the FRK protein in samples. With its high specificity and inhibitory properties, the FRK antibody is an essential component in many research studies focused on understanding cellular signaling pathways and their implications in different diseases.PER1 antibody
PER1 antibody was raised in mouse using recombinant Human Period Homolog 1 (Drosophila)MUC12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MUC12 antibody, catalog no. 70R-6626
Purity:Min. 95%VPS53 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VPS53 antibody, catalog no. 70R-3481Purity:Min. 95%CPA1 antibody
The CPA1 antibody is a highly specific monoclonal antibody that targets collagen. It is commonly used in the field of Life Sciences for various applications. This antibody can be used to detect the presence of collagen in samples, making it a valuable tool for research and diagnostic purposes. The CPA1 antibody has been extensively tested and validated, ensuring its reliability and accuracy.WDR21A antibody
WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
