Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,659 products)
- By Biological Target(100,174 products)
- By Pharmacological Effects(6,846 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,912 products)
- Secondary Metabolites(14,345 products)
Found 130238 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MTRF1L antibody
MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHLSMS antibody
The SMS antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to neutralize epidermal growth factor (EGF) and interleukin-6 (IL-6), two important signaling molecules involved in cellular growth and inflammation. This antibody specifically targets the glycoprotein receptors on the cell surface, blocking their interaction with EGF and IL-6 and preventing downstream signaling events.IL28R α antibody
IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVPurity:Min. 95%Tryptophan Hydroxylase antibody
Tryptophan Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and bind to tryptophan hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of tryptophan hydroxylase in different tissues and cell types.Myotubularin antibody
The Myotubularin antibody is a synthetic polypeptide that acts as an antigen in the body. It is commonly used in research and diagnostic applications to detect and study myotubularin, a protein involved in various cellular processes. This antibody specifically targets myotubularin and can be used to identify its presence or absence in biological samples.PNPLA5 antibody
PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
B71 antibody
B71 antibody was raised in rabbit using highly pure recombinant murine B7-1 (Mouse B7-1) as the immunogen.Purity:Min. 95%FRK antibody
FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHPurity:Min. 95%IL7 antibody
IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.Purity:Min. 95%CTCFL antibody
CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogenPurity:Min. 95%Enhanced Universal IHC Diluent/Blocker/Stabilizer
Enhanced Universal Diluent/Blocker/Stabilizer for use in IHCPurity:Min. 95%KLHL5 antibody
KLHL5 antibody was raised in rabbit using the N terminal of KLHL5 as the immunogenPurity:Min. 95%NMT2 antibody
The NMT2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has the ability to neutralize multidrug resistance and inhibit the growth of hormone peptides. It targets lipase enzymes, including lipoprotein lipase, and has cytotoxic effects on adipose cells. Additionally, the NMT2 antibody has been shown to have natriuretic properties and can neutralize transforming growth factor-beta (TGF-beta). With its potent antibiotic activity and specificity, this monoclonal antibody is an invaluable asset in various research applications.
Haloperidol antibody
The Haloperidol antibody is a nuclear monoclonal antibody that targets the tyrosine protein complex. It has been specifically designed to neutralize the effects of Haloperidol, a commonly used antipsychotic medication. This antibody binds to the target protein, preventing its interaction with other molecules and inhibiting its activity. The Haloperidol antibody has been extensively tested and validated for use in various applications, including research in life sciences. It is produced using high-quality excipients and inhibitors to ensure stability and efficacy. Additionally, this antibody has shown promising results in studies involving insulin-like growth factor binding proteins, fibronectin, collagen, and low-density lipoprotein receptors. With its specificity and reliability, the Haloperidol antibody is a valuable tool for researchers in the field of multidrug therapy.Purity:Min. 95%
