Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,664 products)
- By Biological Target(100,178 products)
- By Pharmacological Effects(6,846 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(355 products)
- Plant Biology(6,912 products)
- Secondary Metabolites(14,344 products)
Found 130270 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
EXOC3 antibody
EXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFGALNT13 antibody
GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKIPurity:Min. 95%AHSG antibody
The AHSG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize alpha-fetoprotein (AFP), a protein complex that plays a crucial role in various physiological processes. The AHSG antibody specifically binds to AFP and inhibits its activity, making it an invaluable tool for studying the function of this protein.PGBD3 antibody
PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSLC13A3 antibody
SLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFTSGA13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSGA13 antibody, catalog no. 70R-3278Purity:Min. 95%SMA antibody
The SMA antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP). It is activated to bind with high affinity to AFP, making it a valuable tool in various research and diagnostic applications. This antibody has been used in studies related to heparin-induced thrombocytopenia (HIT), where it has shown promising results in detecting HIT antibodies. Furthermore, the SMA antibody has also been utilized in research on β-catenin and epidermal growth factor (EGF) signaling pathways. It has been shown to inhibit the activity of β-catenin and block EGF-induced cell proliferation. Additionally, this antibody has been used in studies related to antiphospholipid antibodies and interferon signaling pathways. Its high specificity and affinity make it an essential tool for researchers in the field of Life Sciences.GFAP antibody
GFAP antibody was raised in Guinea Pig using Gliafilament protein purified from bovine spinal cord as the immunogen.GNMT antibody
The GNMT antibody is a monoclonal antibody that targets the enzyme glycine N-methyltransferase (GNMT). It has been shown to have various therapeutic applications, including the treatment of thrombocytopenia and certain types of cancer. The GNMT antibody specifically binds to GNMT and inhibits its activity, which can lead to the suppression of tumor growth and metastasis. Additionally, this antibody has shown potential in modulating the immune response by interfering with interferon signaling pathways and enhancing the cytotoxic effects of other immune cells. With its specificity and versatility, the GNMT antibody holds promise in the field of life sciences for both research and clinical applications.
