Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,693 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(400 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
WNT3 antibody
The WNT3 antibody is a growth factor medicament that is used in biochemical research and Life Sciences. It is a monoclonal antibody that specifically targets and binds to the activated form of WNT3, a crucial signaling molecule involved in various cellular processes. This antibody is commonly used in experiments to study the role of WNT3 in development, tissue regeneration, and disease progression.MYBL2 antibody
MYBL2 antibody was raised in mouse using recombinant V-Myb Myeloblastosis Viral Oncogene Homolog (Avian)-Like 2 (Mybl2)KLK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLK2 antibody, catalog no. 70R-3860Purity:Min. 95%ZNF786 antibody
ZNF786 antibody was raised in rabbit using the N terminal of ZNF786 as the immunogenPurity:Min. 95%GGT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GGT2 antibody, catalog no. 70R-8808Purity:Min. 95%TIE1 antibody
TIE1 antibody was raised in rabbit using a 20 amino acid peptide of human TIE1 as the immunogen.
Purity:Min. 95%NFKB1 antibody
The NFKB1 antibody is a highly specialized protein that belongs to the Life Sciences category. It is a monoclonal antibody that specifically targets and interacts with the NFKB1 protein. This antibody has been extensively studied and proven to be effective in various research applications.KCNMA1 antibody
KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Purity:Min. 95%Rubella virus antibody (FITC)
Rubella virus antibody (FITC) was raised in goat using Rubeola strain HPV77 as the immunogen.
JMJD2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD2B antibody, catalog no. 70R-2881Purity:Min. 95%
