Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(100,795 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(508 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CYP1A2 antibody
The CYP1A2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a cross-linking agent and is commonly used in colloidal assays to detect the presence of specific proteins, such as TNF-α. This antibody has been extensively studied and has shown high affinity for its target antigen, making it a valuable tool in various research applications.Donkey anti Mouse IgG (H + L) (biotin)
Donkey anti-mouse IgG (H + L) (biotin) was raised in donkey using mouse IgG (H&L) as the immunogen.ZNF780A antibody
ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogenPurity:Min. 95%Caspase 1 antibody
The Caspase 1 antibody is a highly specialized antibody that specifically targets and neutralizes the activated form of Caspase 1. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.Ndufv2 antibody
Ndufv2 antibody was raised in rabbit using the C terminal of Ndufv2 as the immunogenPurity:Min. 95%CD45 antibody (Azide Free)
CD45 antibody (Azide free) was raised in Rat using CD45/LCA as the immunogen.MAFK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAFK antibody, catalog no. 20R-1260
Purity:Min. 95%PNMT antibody
The PNMT antibody is a high-quality, buffered monoclonal antibody that is used in various assays and research applications. It specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT) and has been proven to be highly reactive and specific in detecting PNMT in human serum samples. This antibody is commonly used in studies related to fibrinogen, mesenchymal stem cells, and protein carbonyls. Additionally, it can be immobilized on an electrode for use in electrode-based assays.
RanBP3 antibody
RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHPurity:Min. 95%Annexin A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-1703Purity:Min. 95%Slc9a5 antibody
Slc9a5 antibody was raised in rabbit using the C terminal of Slc9a5 as the immunogenPurity:Min. 95%DAZ4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DAZ4 antibody, catalog no. 70R-4895Purity:Min. 95%Androgen receptor antibody
The Androgen Receptor Antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been specifically designed to target and bind to the androgen receptor, a key protein involved in various biological processes. This antibody is activated upon binding to the receptor, allowing for further investigation and analysis.LRCH4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRCH4 antibody, catalog no. 70R-7117Purity:Min. 95%ZNF385 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385 antibody, catalog no. 70R-7881Purity:Min. 95%
