Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,854 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(528 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Presenilin 2 antibody
Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Purity:Min. 95%Gamma-Glutamyl Transpeptidase protein (Porcine)
Purified native Porcine Gamma-Glutamyl Transpeptidase proteinPurity:Min. 95%BCAT1 antibody
The BCAT1 antibody is a test compound that specifically targets and binds to the BCAT1 protein. This monoclonal antibody has been developed for use in various research applications in the field of Life Sciences. The BCAT1 protein is involved in several important cellular processes, including amino acid metabolism and energy production. By targeting BCAT1, this antibody can help researchers gain a better understanding of its function and potential therapeutic applications.BIK antibody
The BIK antibody is a highly specialized monoclonal antibody that targets and neutralizes the activity of BIK, a protein involved in regulating cell death. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It has been shown to inhibit the activity of BIK, preventing its interaction with other proteins and ultimately leading to a reduction in cell death. Additionally, the BIK antibody has been found to have neutralizing effects on reactive oxygen species, which are known to contribute to inflammation and tissue damage. This antibody can be used in a variety of applications, including studies involving human serum, interleukin-6, mesenchymal stem cells, and influenza hemagglutinin. Whether you're conducting cutting-edge research or developing innovative therapies, the BIK antibody is an invaluable tool for your scientific endeavors.Purity:Min. 95%CIRBP antibody
CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGIKZF3 antibody
IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogenPurity:Min. 95%MCL1 antibody
The MCL1 antibody is a highly specialized monoclonal antibody that targets the growth factor MCL1. It plays a crucial role in regulating cell survival and apoptosis. This antibody specifically binds to MCL1, inhibiting its activity and promoting cell death in cancer cells.
SQSTM1 antibody
SQSTM1 antibody is a monoclonal antibody that targets the SQSTM1 protein, also known as p62. This protein plays a crucial role in various cellular processes, including hepatocyte growth, TNF-α signaling, collagen degradation, and autophagy. The SQSTM1 antibody specifically binds to the SQSTM1 protein and can be used for various applications in research and diagnostics.
NT-proBNP antibody
NT-proBNP antibody was raised in mouse using synthetic N-terminal pro brain natriuretic peptide (NT-proBNP), corresponding to amino acid residues 13-27 as the immunogen.IL4 antibody
The IL4 antibody is a monoclonal antibody that targets the β-catenin protein. It has cytotoxic properties and acts as a growth factor inhibitor. This antibody specifically binds to IL4, preventing its interaction with its receptor and inhibiting downstream signaling pathways. Additionally, the IL4 antibody has anti-dnp antibodies, antiangiogenic effects, and interferon neutralizing activity. It can induce apoptosis by activating caspase-9 and has been shown to have potent antitumor effects in various cancer models. The IL4 antibody is widely used in Life Sciences research for studying endothelial growth, immune responses, and cell lysis.ID3 antibody
The ID3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to fibroin, a protein involved in various cellular processes. This monoclonal antibody has been extensively studied and is known for its high specificity and affinity towards fibroin.
