Biochemicals and Reagents

Rabbit polyclonal HLA-DOB antibody

Purified Polyclonal INPP5E antibody

JWH-018 Conjugate for use in immunoassays

ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids PECGRQSLVELLIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSL

H2AFY antibody was raised using the N terminal of H2AFY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV

Purified Rabbit polyclonal MYB23 antibody

Rabbit polyclonal TAS2R39 antibody

Purified Polyclonal BAIAP2L1 antibody

The AP2M1 antibody is an anticoagulant that is widely used in the field of Life Sciences. It specifically targets a virus surface antigen and has been shown to have neutralizing effects on the virus. This antibody can be immobilized on various surfaces, such as electrodes, for further study and analysis. In addition, the AP2M1 antibody has the ability to bind to fibrinogen, a key molecule involved in blood clotting. This makes it a valuable tool in research related to coagulation disorders and thrombosis. The AP2M1 antibody is available as a monoclonal antibody, derived from human serum, ensuring high specificity and reliability in experiments. Its carbonic 3-kinase activity further enhances its functionality and versatility in various applications within the field of Life Sciences.

PLCG2 antibody is a polyclonal antibody that specifically targets the PLCG2 protein. PLCG2 is an enzyme involved in the production of second messengers, such as inositol trisphosphate (IP3) and diacylglycerol (DAG), which play important roles in cellular signaling pathways. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to be effective in detecting and quantifying PLCG2 expression levels in different tissues and cell types. The use of this antibody can provide valuable insights into the function and regulation of PLCG2, as well as its potential role in various diseases and conditions.

Rabbit polyclonal SNAP29 antibody

ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS

LENG9 antibody was raised in Rabbit using Human LENG9 as the immunogen

Rabbit polyclonal Tau antibody (Ser519/202)

HK1 antibody was raised in rabbit using the N terminal of HK1 as the immunogen

Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.

UCP1 antibody was raised in rabbit using a 12 amino acid peptide from mouse/rat UCP1 as the immunogen.