CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130636 products of "Biochemicals and Reagents"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • TPT1 antibody


    Rabbit polyclonal TPT1 antibody

    Ref: 3D-70R-20949

    50µl
    540.00€
  • ESR2 antibody


    ESR2 antibody was raised in Rabbit using Human ESR2 as the immunogen

    Ref: 3D-70R-17152

    50µl
    540.00€
  • Complement component C9 Heavy


    Complement component C9 is a fundamental factor of the complement system where several subunits of C9 form a complex with C5b, C6, C7 and C8 to generate the membrane attack complex (MAC). The MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.C9 is a member of the Mac perforin-like superfamily. These all have a thrombospondin-1 domain, a low-density lipoprotein receptor-associated domain, a MACPF domain and an epidermal growth factor domain. Moreover C9 has the ability to form poly-C9 which can from structures similar to that of the MAC pore.Overall the main function of the complement system is to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cells by the MAC. The complement system as a whole can be associated with the neurological diseases, bacterial meningitis, thrombotic disorders, neurological and autoimmune diseases.The leucine residue at position 7 has been isotopically labelled with carbon-13 (6) and nitrogen-15 (1).
    Purity:Min. 95%
    Molecular weight:1,248.8 g/mol

    Ref: 3D-CRB1301341

    25nMol
    470.00€
  • RREB1 antibody


    The RREB1 antibody is a powerful tool used in Life Sciences for various applications. This antibody specifically targets the RREB1 protein, which plays a crucial role in regulating gene expression and cellular processes. By binding to RREB1, this antibody can be used to study its function and activity in different biological systems.

    Ref: 3D-70R-21678

    50µl
    540.00€
  • CK2 alpha 1 antibody


    CK2 alpha 1 antibody was raised using the middle region of CSNK2A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

    Ref: 3D-70R-2696

    100µl
    828.00€
  • C1orf106 antibody


    C1orf106 antibody was raised in Rabbit using Human C1orf106 as the immunogen

    Ref: 3D-70R-16073

    50µl
    540.00€
  • PUF60 antibody


    The PUF60 antibody is a polyunsaturated polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the PUF60 protein, which plays a crucial role in various cellular processes such as glucagon and chemokine signaling. This antibody has been extensively tested and validated for its reactivity against a wide range of test substances including mda-mb-231 cells, reactive polymers, oligodeoxynucleotides, and more. The PUF60 antibody is highly specific and exhibits strong binding affinity, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, chromatographic techniques, and electrophoresis. Whether you are conducting research or developing new therapeutics, this high-quality monoclonal antibody will provide accurate and reliable results.

    Ref: 3D-70R-19661

    50µl
    540.00€
  • TLP13 antibody


    Purified Rabbit polyclonal TLP13 antibody

    Ref: 3D-70R-34874

    100µl
    737.00€
  • KDM1A (662-668) Heavy


    Lysine-specific histone demethylase 1A (LSD1) or lysine (K)-specific demethylase 1A (KDM1A) is a protein in humans that encodes a flavin-dependent monoamine oxidase. The KDM1A protein can demethylate mono- and di-methylated lysines, specifically histone 3, lysines 4 and 9. KDM1A has crucial roles in embryogenesis and tissue-specific differentiation, as well as oocyte growth. KDM1A also appears to play a clinically important role in epigenetic reprogramming zygote formation. Deletion of the gene for KDM1A can have effects on the growth and differentiation of embryonic stem cells. KDM1A is also thought to play a role in cancer, as poorer outcomes can be correlated with higher expression of this gene. Therefore, the inhibition of KDM1A may be a possible treatment for cancer.The arginine residue at position 7 of this peptide is isotopically labelled with Carbon-13 (6) and Nitrogen-15 (4).
    Purity:Min. 95%
    Molecular weight:917.5 g/mol

    Ref: 3D-CRB1300301

    25nMol
    470.00€
  • UGT2B4 antibody


    Rabbit polyclonal UGT2B4 antibody

    Ref: 3D-70R-21156

    50µl
    540.00€
  • LTA4H antibody


    The LTA4H antibody is a monoclonal antibody that specifically targets the LTA4H protein. This protein plays a crucial role in various biological processes, including inflammation and immune response. The LTA4H antibody has been extensively studied for its potential therapeutic applications in diseases such as cancer, autoimmune disorders, and neurodegenerative diseases.

    Ref: 3D-10R-4720

    100µl
    1,179.00€
  • Keratin K28 antibody


    Keratin K28 antibody was raised in Guinea Pig using synthetic peptide of human keratin K28 coupled to KLH as the immunogen.

    Purity:Min. 95%

    Ref: 3D-20R-2640

    100µl
    1,018.00€
  • MAP1S antibody (biotin)


    Rabbit polyclonal MAP1S antibody (biotin)

    Ref: 3D-60R-1620

    100µg
    562.00€
  • AGPAT5 antibody


    AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE

    Purity:Min. 95%

    Ref: 3D-70R-7253

    100µl
    828.00€
  • ZMPSTE24 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of ZMPSTE24 antibody, catalog no. 70R-7342
    Purity:Min. 95%

    Ref: 3D-33R-5572

    100µg
    265.00€
  • ZNF527 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF527 antibody, catalog no. 20R-1247
    Purity:Min. 95%

    Ref: 3D-33R-3352

    100µg
    265.00€
  • TSC2 antibody


    The TSC2 antibody is a highly effective growth factor that plays a crucial role in various Life Sciences applications. It has been extensively studied for its ability to regulate osteopontin and e-cadherin expression, making it an invaluable tool in research and experimentation. This polyclonal antibody offers exceptional hybridization capabilities, allowing for accurate detection and analysis of target proteins. Additionally, the TSC2 antibody has shown promising results in inhibiting angptl3 and anti-cd33 activity, further expanding its potential applications. With its specificity towards e-cadherin and β-catenin, this monoclonal antibody provides precise targeting for adipose-related studies. Whether you're conducting basic research or developing therapeutic interventions, the TSC2 antibody is an essential tool for any scientist looking to delve into the intricacies of cellular signaling pathways and protein interactions.
    Purity:Min. 95%

    Ref: 3D-70R-51670

    100µl
    602.00€
  • PRSS2 Protein


    PRSS2 protein is a plasma protein that plays a crucial role in various biological processes. It is commonly used in the field of Life Sciences for research purposes. PRSS2 protein can be detected and measured in plasma levels, making it a valuable tool for studying its functions and interactions with other molecules.
    Purity:Min. 95%

    Ref: 3D-30R-3413

    1mg
    3,354.00€
  • GABBR2 antibody


    GABBR2 antibody was raised in Rabbit using Human GABBR2 as the immunogen

    Ref: 3D-70R-17392

    50µl
    540.00€
  • IF3EI antibody


    Rabbit polyclonal IF3EI antibody

    Ref: 3D-70R-32220

    100µg
    502.00€