Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CHN2 antibody
CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCCalcitonin (Human)
CAS:Calcitonin is a hormone produced by the C cells (also known as parafollicular cells) in the thyroid gland. Its main function is to regulate the levels of calcium and phosphate in the blood. Calcitonin works by inhibiting the activity of osteoclasts, which are cells that break down bone tissue and release calcium and phosphate into the bloodstream. This leads to a decrease in the amount of calcium and phosphate in the blood. Calcitonin is released in response to high levels of calcium in the blood, and it acts to reduce these levels by increasing the excretion of calcium by the kidneys and inhibiting the absorption of calcium by the intestines. It also promotes the storage of calcium in the bones, which helps to maintain their strength and density. Calcitonin may be used therapeutically to treat conditions such as osteoporosis and hypercalcemia (high levels of calcium in the blood) or even diagnostically as a marker for tumors in medullary thyroid cancer. This product has a disulfide bond between Cys1-Cys7 and is available as a 0.5mg vial.Formula:C151H226N40O45S3Purity:Min. 95%Molecular weight:3,417.8 g/molFT206
CAS:FT206 is a potent protein kinase inhibitor that has shown great promise in the fight against cancer. This medicinal compound works by targeting specific kinases present in cancer cells and tumors, ultimately leading to apoptosis or programmed cell death. FT206 is a human analog of a Chinese urine compound that has been used for centuries as an anticancer agent. This powerful inhibitor has been found to be effective against a wide range of cancer types, making it a promising candidate for future cancer treatments. In addition, FT206 has been shown to have minimal toxicity in healthy cells, making it an attractive option for cancer therapy. With its ability to selectively target kinases involved in tumor growth and survival, FT206 represents a significant advance in the development of new cancer therapies.Formula:C25H29N5OSPurity:Min. 95%Molecular weight:447.6 g/molCystatin C protein
Cystatin C protein is a nuclear protein that belongs to the group of Conjugated Proteins. It acts as a growth factor and plays a crucial role in regulating various biological processes. Cystatin C functions as an inhibitor of cysteine proteases, which are enzymes involved in the breakdown of proteins. By inhibiting these enzymes, Cystatin C helps maintain the balance between protein synthesis and degradation.Purity:Min. 95%Chromogranin A (Human, 286-301 Amide)
CAS:Chromogranin A (Human, 286-301 Amide) is a protein that belongs to the class of peptides. It is a major component of the chromaffin granules in the adrenal medulla and in neuroendocrine cells in various parts of the brain. There are two types of chromogranin A, which have 286-301 amino acids. Chromogranin A is an activator for G-protein coupled receptors, ion channels, and ligands. This protein has been used as a research tool in Cell Biology and as an inhibitor in Pharmacology.
Formula:C78H123N21O27SPurity:Min. 95%Molecular weight:1,819 g/molMLSTD1 antibody
MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDMPurity:Min. 95%HIP1 antibody
The HIP1 antibody is a highly specialized reagent used in life sciences research. It is a polyclonal antibody that specifically targets hematopoietic and gastrointestinal stromal proteins. This antibody has the ability to bind to DNA double-strand breaks, making it an invaluable tool for studying DNA repair mechanisms. The HIP1 antibody can be used in various applications, including immunohistochemical staining and protein interaction studies. Researchers can use this antibody as a test compound to evaluate the efficacy of potential inhibitors or affinity ligands. With its high specificity and versatility, the HIP1 antibody is an essential tool for scientists working in the field of molecular biology and genetics.
UPGL00004
CAS:UPGL00004 is a potent allosteric inhibitor of bacterial glutamate dehydrogenase (GDH) that has been shown to be effective in inhibiting growth in epithelial mesenchymal cells. This compound was originally isolated from the soil bacterium Geobacillus sp., and has shown activity against a variety of cancers, including colon cancer, breast cancer, and melanoma. UPGL00004 is structurally related to other heterocycloalkyl-based inhibitors of GDH, such as 3-aminoquinoxaline-2,4(1H,3H)-dione and 2-aminopyridine-N-oxide.
Formula:C25H26N8O2S2Purity:Min. 95%Molecular weight:534.66 g/molAcemetacin-d4
CAS:Please enquire for more information about Acemetacin-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H18ClNO6Purity:Min. 95%Molecular weight:419.8 g/molAbcf1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Abcf1 antibody, catalog no. 70R-8566Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly effective monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is designed to bind to the EGFR protein and inhibit its activity, thereby preventing the growth and proliferation of cancer cells. This antibody has been extensively studied in the field of life sciences and has shown promising results in various preclinical and clinical trials.Purity:Min. 95%MPDC
CAS:MPDC is a plant extract from Solanum tuberosum that has shown to have properties that can be used in the treatment of cancer, atherosclerosis, and cardiac diseases. MPDC has been shown to maintain mitochondrial membrane potential and act as an actuator in plants. It also inhibits the transcriptase polymerase chain reaction and suppresses growth factor activity. This extract also contains a number of molecules with anti-inflammatory and anti-atherogenic effects. MPDC has been shown to inhibit the growth of mesenchymal cells, which are responsible for tissue remodeling. It has been found to reduce the diameter of atrial cells in rats by inhibiting angiotensin II type I receptor expression. The extract also contains a number of molecules with anti-inflammatory and anti-atherogenic effects. MPDC has been shown to inhibit the growth of mesenchymal cells, which are responsible for tissue remodeling.Formula:C7H9NO4Purity:Min. 95%Molecular weight:171.15 g/molFAM62C antibody
FAM62C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANKPurity:Min. 95%Thiophene-4
CAS:Thiophene-4 is a chemical compound with the molecular formula C4H6S. It is a colorless liquid that has been shown to bind to and activate the benzodiazepine receptor, leading to its potential use as a pharmaceutical agent for the treatment of anxiety disorders. Thiophene-4 also has transport properties, which have been characterized by x-ray diffraction data. This molecule was detected at subpicomolar concentrations in biological samples, and it exhibited significant cytotoxicity in rat liver microsomes. The basic structure of thiophene-4 is a fatty acid, which may be responsible for its light emission properties when exposed to ultraviolet light.Formula:C16H11F5N2O4SPurity:Min. 95%Molecular weight:422.3 g/mol2-[[(2E)-4-[4-[bis(4-Fluorophenyl)methyl]-1-piperazinyl]-2-buten-1-yl]oxy]-acetic acid hydrochloride
CAS:2-[[(2E)-4-[4-[bis(4-fluorophenyl)methyl]-1-piperazinyl]-2-buten-1-yl]oxy]acetic acid hydrochloride is a peptide that has been shown to bind to the receptor for human interleukin 1 alpha. It has also been found to inhibit the activity of ion channels, such as potassium and calcium channels. 2-[[(2E)-4-[4-[bis(4-fluorophenyl)methyl]-1-piperazinyl]-2-buten-1-yl]oxy]acetic acid hydrochloride is a high purity product with CAS No. 607736-84-5.Formula:C23H28Cl2F2N2O3Purity:Min. 95%Molecular weight:489.4 g/mol
![2-[[(2E)-4-[4-[bis(4-Fluorophenyl)methyl]-1-piperazinyl]-2-buten-1-yl]oxy]-acetic…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FHZA73684.webp&w=3840&q=75)