Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(100,795 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(508 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ELTD1 antibody
The ELTD1 antibody is a highly specialized antibody that targets the ELTD1 protein, which is involved in various biological processes. This antibody is commonly used in life sciences research and has been extensively studied for its role in steroid metabolism. It can be used as a tool for studying the function and localization of ELTD1 in different cell types.Plakophilin 3 antibody
Plakophilin 3 antibody was raised in Guinea Pig using human recombinant plakophilin 3 peptide purified from E. coli as the immunogen.Purity:Min. 95%HMGCL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCL antibody, catalog no. 70R-5397Purity:Min. 95%P2rx2 antibody
P2rx2 antibody was raised in rabbit using the middle region of P2rx2 as the immunogenPurity:Min. 95%SLC26A8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A8 antibody, catalog no. 70R-1764
Purity:Min. 95%CIDEC antibody
CIDEC antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to detect and bind to CIDEC, an antigen that plays a crucial role in lipid metabolism and energy homeostasis. This antibody has been extensively validated for use in immunohistochemistry and other applications.GPR115 antibody
GPR115 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%MSH2 antibody
MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVINSIG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6636Purity:Min. 95%MAPK3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK3 antibody, catalog no. 70R-5574Purity:Min. 95%NOL6 antibody
NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG
