Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ALOX15B antibody
ALOX15B antibody was raised using the middle region of ALOX15B corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVIPurity:Min. 95%Cytokeratin 84 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KRT84 antibody, catalog no. 70R-3002
Purity:Min. 95%Vaccinia Virus antibody
The Vaccinia Virus antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the Vaccinia virus, which is a member of the poxvirus family. This antibody recognizes a conformational epitope on the surface of the virus and has been shown to have high neutralizing activity.SLFN12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLFN12 antibody, catalog no. 70R-4360Purity:Min. 95%SPOP antibody
SPOP antibody was raised in rabbit using the C terminal of SPOP as the immunogenPurity:Min. 95%COMMD8 antibody
COMMD8 antibody was raised in rabbit using the middle region of COMMD8 as the immunogenPurity:Min. 95%CANX antibody
CANX antibody was raised in rabbit using the middle region of CANX as the immunogenPurity:Min. 95%NGAL antibody
The NGAL antibody is a monoclonal antibody used in Life Sciences research. It is commonly used in immunoassays to detect and quantify NGAL (Neutrophil Gelatinase-Associated Lipocalin) levels in human serum. This antibody has high specificity and sensitivity, making it ideal for accurate and reliable measurements. The NGAL antibody can also be used in assays to detect autoantibodies or anti-drug antibodies. It is buffered and stable, ensuring consistent performance in various experimental conditions. Additionally, this antibody can be conjugated with different markers such as carbon quantum dots or colloidal gold for visualization purposes. Whether you are studying kidney diseases, inflammation, or drug development, the NGAL antibody is an essential tool for your research needs.Pfkfb2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Pfkfb2 antibody, catalog no. 70R-9421
Purity:Min. 95%PHF12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHF12 antibody, catalog no. 70R-8895Purity:Min. 95%
