Biochemicals and Reagents

The Diethylstilbestrol antibody is a monoclonal antibody that specifically targets and binds to Diethylstilbestrol (DES), a synthetic estrogen. This antibody has been extensively studied in the field of Life Sciences and has shown significant potential in various applications.

Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Purified Rabbit polyclonal ZNF816A antibody

SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT

The hPL antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activity of human placental lactogen (hPL), which is an important growth factor involved in various physiological processes. The hPL antibody has been extensively studied for its cytotoxic effects on cancer cells, particularly those overexpressing the HER2 protein. It works by binding to HER2 receptors on the surface of cancer cells, inhibiting their growth and promoting cell death. Additionally, the hPL antibody has been shown to interfere with the Wnt/β-catenin signaling pathway, which plays a crucial role in cell proliferation and differentiation. This unique property makes it a valuable tool for studying cellular processes related to development, tissue regeneration, and disease progression. The hPL antibody is highly specific and exhibits excellent binding affinity due to its precise glycosylation pattern. It can be used in a variety of experimental techniques, including immunohistochemistry, Western blotting,

A synthetic peptide for use as a blocking control in assays to test for specificity of Pdyn antibody, catalog no. 70R-9818

Rabbit polyclonal NKX24 antibody

CD45 antibody was raised in mouse using chicken CD45 as the immunogen.

Mouse monoclonal GPHN antibody

CAMKK2 antibody was raised in Rabbit using Human CAMKK2 as the immunogen

Rabbit Polyclonal ASK1 antibody (Ser966)

MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

The MAX antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed for use in research and diagnostic applications. This antibody has been extensively tested and validated for its efficacy in various experimental settings.

A synthetic peptide for use as a blocking control in assays to test for specificity of COG2 antibody, catalog no. 70R-2899

Vabicaserin is a drug that belongs to the class of glycoside derivatives. It is an agonist of 5-HT2C receptors, which are located in the striatum and other parts of the brain. Vabicaserin has been shown to increase extracellular dopamine levels in the striatum. This drug has also been shown to have a therapeutic effect on chronic fatigue syndrome and other diseases involving inflammation of the nervous system. Vabicaserin has been shown to be effective against sodium-dependent glucose co-transporters 1 and 2 (SGLT1 and SGLT2) in human liver cells, which may lead to its use as a treatment for type 2 diabetes mellitus.

TBAJ-587 is a novel anti-tuberculosis drug that is a proton pump inhibitor and an antibiotic. TBAJ-587 inhibits bacterial growth by binding to the membrane potential of the bacteria, leading to decreased fatty acid transport and accumulation in the cell. TBAJ-587 also has antibacterial activity against gram positive bacteria, such as methicillin resistant Staphylococcus aureus. Resistant mutants of Mycobacterium tuberculosis have been shown to be more sensitive to TBAJ-587 compared with wild type strains.

Sch-42495 racemate is a synthetic compound, categorized as a central nervous system (CNS) agent, derived from laboratory synthesis. This racemate comprises a mixture of enantiomers that display activity affecting neurotransmitter systems, which makes it of particular interest in neuropharmacology. The mode of action involves modulation of specific receptor pathways in the CNS, potentially influencing neurotransmitter release and receptor sensitivity.

The 5-((3-Ethynylphenyl)amino)pyrimido[4,5-c]quinoline-8-carboxylic acid is a ligand that has been used as a research tool to study the interactions between antibodies and peptides. It has also been used in pharmacology to study the interactions between ligands and ion channels. The CAS number for this compound is 1009821-06-0.