Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
JD 5037
CAS:JD 5037 is a monoclonal antibody that inhibits the binding of endocannabinoids to their receptors. This drug has been shown to be effective in animal models of obesity, diabetes, and cancer. JD 5037 binds to the CB2 receptor and antagonizes the effects of endocannabinoids by preventing them from binding. The high affinity of this drug for the CB2 receptor may be due to its tautomeric structure. This drug also appears to have potential as an anticancer agent due to its ability to bind and inhibit rapamycin complex-1 (raptor) and cb2 receptor.Formula:C27H27C12N5O3SPurity:Min. 95%Molecular weight:645.73 g/molAdenovirus antibody
Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.B3GALNT2 antibody
B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFLPurity:Min. 95%Cyclin E1 antibody (Thr77)
Human synthetic phosphopeptide (Thr77) region immunogen, Purified Rabbit polyclonal Cyclin E1 antibody (Thr77)NPM antibody
The NPM antibody is a highly reactive antibody that specifically targets Nucleophosmin (NPM), a multifunctional protein involved in various cellular processes. This antibody has been extensively used in research and diagnostics due to its ability to detect NPM in human serum and tissues.DENND1B antibody
DENND1B antibody was raised using the middle region of DENND1B corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYPurity:Min. 95%SPNS2 antibody
SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRYClcn5 antibody
Clcn5 antibody was raised in rabbit using the middle region of Clcn5 as the immunogenPurity:Min. 95%CDCP1 antibody
The CDCP1 antibody is a highly effective monoclonal antibody that specifically targets the CDCP1 protein. This antibody is designed to bind to and neutralize the activity of CDCP1, which plays a crucial role in various cellular processes. By blocking the function of CDCP1, this antibody inhibits the formation of CDCP1 dimers and prevents its activation.GW-590735
CAS:GW-590735 is a potent, non-peptide, orally bioavailable, small molecule activator of PPARs. It binds to the PPAR receptor and activates it by binding to the ligand binding domain, thereby increasing the expression of genes that are involved in lipid metabolism. GW-590735 has been shown to have anti-inflammatory effects in animal models of bowel disease, as well as beneficial effects on insulin sensitivity and energy homeostasis. GW-590735 has also been shown to activate PPARγ in cancer cells and reduce tumor growth. In addition, this drug has been shown to be effective for treatment of inflammatory diseases such as rheumatoid arthritis and Crohn's disease.Purity:Min. 95%CSRP2 antibody
CSRP2 antibody was raised in rabbit using the C terminal of CSRP2 as the immunogenPurity:Min. 95%
