Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
p53 antibody
The p53 antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets and binds to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By binding to p53, this antibody can help researchers better understand the functions and mechanisms of this important protein.Purity:Min. 95%Rabbit anti Hamster IgG (H + L)
This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.Purity:Min. 95%AMFR antibody
AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
Goat anti Bovine IgG
Goat anti-bovine IgG was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%INTS4 antibody
INTS4 antibody was raised in rabbit using the middle region of INTS4 as the immunogenPurity:Min. 95%LAG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LAG3 antibody, catalog no. 70R-9684Purity:Min. 95%MKK4 antibody
The MKK4 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MKK4, an important protein involved in cell signaling pathways. This antibody is commonly used in research and laboratory settings to study the role of MKK4 in various cellular processes.APOL5 antibody
APOL5 antibody was raised in rabbit using the C terminal of APOL5 as the immunogenPurity:Min. 95%CCIN antibody
Calicin antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine calicin coupled to KLH as the immunogen.Purity:Min. 95%Motilin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MLN antibody, catalog no. 70R-6243Purity:Min. 95%UGCG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UGCG antibody, catalog no. 70R-7359Purity:Min. 95%Otospiralin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OTOS antibody, catalog no. 70R-4531Purity:Min. 95%VTN antibody
VTN antibody was raised in rabbit using the N terminal of VTN as the immunogenPurity:Min. 95%Aak1 antibody
Aak1 antibody was raised in rabbit using the C terminal of Aak1 as the immunogenPurity:Min. 95%Cacng1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Cacng1 antibody, catalog no. 70R-9608Purity:Min. 95%GLT8D1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLT8D1 antibody, catalog no. 70R-6824
Purity:Min. 95%
