Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,570 products)
- By Biological Target(100,766 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(477 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MAP Kinase antibody
The MAP Kinase antibody is a basic protein that plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target the mitogen-activated protein (MAP) kinase pathway. This pathway is involved in signal transduction and regulates important cellular functions such as cell proliferation, differentiation, and survival.KCNC4 antibody
KCNC4 antibody was raised using the middle region of KCNC4 corresponding to a region with amino acids NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIVPurity:Min. 95%PRKAB2 antibody
PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPAS100A9 antibody
The S100A9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the activity of S100A9 protein, which is known to be involved in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor activity of S100A9. It can be used as a valuable tool in research studies focusing on androgen inhibitors, as well as in the development of therapeutics targeting this specific protein. The S100A9 antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and reliability, this antibody is an essential component in any study involving S100A9 protein.BLVRB antibody
BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDFCRL4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FCRL4 antibody, catalog no. 70R-7228Purity:Min. 95%ALAD antibody
ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP
PTDSS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTDSS2 antibody, catalog no. 70R-8841Purity:Min. 95%ATG3 antibody
ATG3 antibody was raised in rabbit using the middle region of ATG3 as the immunogenPurity:Min. 95%
