Biochemicals and Reagents

LILRA4 antibody was raised in Rabbit using Human LILRA4 as the immunogen

Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.

Rabbit polyclonal ABL1 antibody (Tyr412)

Rabbit polyclonal WRKY27.1 antibody

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS18 antibody, catalog no. 70R-4602

LNPEP antibody was raised in Rabbit using Human LNPEP as the immunogen

RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

WDR4 antibody was raised using the C terminal of WDR4 corresponding to a region with amino acids AGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHA

A synthetic peptide for use as a blocking control in assays to test for specificity of CUX2 antibody, catalog no. 70R-8727

The FKHR antibody is a powerful growth factor and hormone peptide that plays a crucial role in various biological processes. It is commonly used in research and diagnostics to detect the presence of FKHR in samples.

CD4 antibody (FITC) was raised in rat using cloned murine CTL line V4 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Apbb1ipsantibody, catalog no. 70R-9495

The FANCC antibody is a highly specialized product that is used in various assays and research applications within the field of Life Sciences. It is an antibody that specifically targets and detects the FANCC protein, which plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is widely used in studies related to collagen, autoantibodies, dopamine, pluripotent stem cells, fetal hemoglobin, heparin cofactor, zinc chelators, and acid residues.

A synthetic peptide for use as a blocking control in assays to test for specificity of MTO1 antibody, catalog no. 70R-2514

Rabbit polyclonal CCR5 antibody (Ser336)