
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12453 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
4-(4-Hydroxyphenoxy)benzoic acid
CAS:<p>4-(4-Hydroxyphenoxy)benzoic acid is a molecule that can be used to treat hypercholesterolemia. It is metabolized in the body to butyric acid, which has been shown to have an anti-inflammatory effect on the bladder and may reduce water permeability of the bladder. 4-(4-Hydroxyphenoxy)benzoic acid can also be used as a choline precursor for acetylcholine synthesis and may have osmotic properties.</p>Formula:C13H10O4Purity:Min. 95%Molecular weight:230.22 g/mol1-Fluoro-5a-androst-2-en-17b-ol acetate
CAS:Controlled Product<p>Please enquire for more information about 1-Fluoro-5a-androst-2-en-17b-ol acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H28FO2Purity:Min. 95%Molecular weight:319.43 g/mol12-Aminododecanoic acid
CAS:<p>12-Aminododecanoic acid is a fatty acid that is used in the manufacture of magnetic particles. It is synthesized by cationic polymerization of 4-tert-butylbenzoic acid and dodecanedioic acid. The process involves the use of water vapor to remove hydrochloric acid from the solution and form a salt, which then reacts with dodecanedioic acid to produce 12-aminododecanoic acid. This compound has been shown to have transport properties for nitrogen atoms and can be used in exfoliated materials such as nanometals. 12-Aminododecanoic acid has also been shown to exhibit redox activity due to its ability to react with hydrogen peroxide.</p>Formula:C12H25NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:215.33 g/molTriphenyl acetic acid
CAS:<p>Intermediate in the synthesis of vilanterol</p>Formula:C20H16O2Purity:Min. 95%Molecular weight:288.34 g/mol1-(4-Isopropylphenyl)-5-oxopyrrolidine-3-carboxylic acid
CAS:<p>Please enquire for more information about 1-(4-Isopropylphenyl)-5-oxopyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H17NO3Purity:Min. 95%Molecular weight:247.29 g/mol2-Amino-3-(1.2-dihydro-2-oxoquinoline-4-yl)propanoic acid
CAS:<p>Please enquire for more information about 2-Amino-3-(1.2-dihydro-2-oxoquinoline-4-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H12N2O3Purity:Min. 95%Molecular weight:232.24 g/mol1-(4-Chlorophenyl)-3-(4-methylphenyl)-1H-pyrazole-5-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-(4-Chlorophenyl)-3-(4-methylphenyl)-1H-pyrazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H13ClN2O2Purity:Min. 95%Molecular weight:312.75 g/molDimethylaminoacetic acid hydrazide dihydrochloride
CAS:<p>Please enquire for more information about Dimethylaminoacetic acid hydrazide dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%3-Chloro-4-cyanophenylboronic acid
CAS:Controlled Product<p>Please enquire for more information about 3-Chloro-4-cyanophenylboronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H5BClNO2Purity:Min. 95%Molecular weight:181.38 g/mol1-(4-Fluorophenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-(4-Fluorophenyl)-3-phenyl-1H-pyrazole-5-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H11FN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:282.27 g/mol2-[(2S,3S,4S)-3-Formyl-5-Methoxycarbonyl-2-Methyl-3,4-Dihydro-2H-Pyran-4-Yl]Acetic Acid
CAS:<p>2-[(2S,3S,4S)-3-Formyl-5-Methoxycarbonyl-2-Methyl-3,4-Dihydro-2H-Pyran-4-Yl]Acetic Acid (PCA) is a natural phenolic compound that is found in olive oil. PCA has been shown to possess antioxidant and antiinflammatory properties. It also has minimal toxicity, with no adverse effects on the liver or kidney. PCA is metabolized by hydrolysis to form hydroxytyrosol and tyrosol. Hydroxytyrosol can be further metabolized to produce the aglycon 2-[(2S,3S,4S)-3-(acetyloxy)-5-(hydroxymethyl)oxolan-4-yl]acetic acid (OHA). OHA is an intermediate in the biosynthesis of erythromycin and other macrolide antibiotics such as</p>Formula:C11H14O6Purity:90%MinMolecular weight:242.23 g/mol2-Thiazoleacetic acid
CAS:<p>2-Thiazoleacetic acid is a heterocyclic compound that can bind to iron and is an efficient ligand for the virus. It has been used as a linker in the synthesis of biologically active methylene compounds. 2-Thiazoleacetic acid also has anti-inflammatory properties and is used to treat inflammatory diseases. The compound reacts with hydrochloric acid, forming an acetic acid derivative. This reaction is catalyzed by metal ions such as Fe2+ or Hg2+. 2-Thiazoleacetic acid can be synthesized from two molecules of formaldehyde, two molecules of hydrogen cyanide, and two molecules of hydroxamic acids.</p>Formula:C5H5NO2SPurity:Min. 95%Molecular weight:143.16 g/mol7-Azaindole-5-carboxylic acid methyl ester
CAS:<p>7-Azaindole-5-carboxylic acid methyl ester is an ester derivative that can be synthesized from the reaction of acetyl chloride and diazotization. 7-Azaindole-5-carboxylic acid methyl ester has been used in research for its biological activity, specifically as a cytotoxic agent. It has also been shown to inhibit the growth of cancer cells by alkylation reactions and cyclization reactions. 7-Azaindole-5-carboxylic acid methyl ester has been shown to have antitumor properties with a mechanism that is not yet fully understood.</p>Formula:C9H8N2O2Purity:Min. 95%Molecular weight:176.17 g/mol1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate
CAS:<p>Please enquire for more information about 1-N-Boc-pyrrolidine-3-(S)-methylcarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molDL-Lactic acid
CAS:<p>DL-lactic acid is a metabolic intermediate that is produced in the muscle cells during anaerobic glycolysis. It is used to treat cancer and has been shown to be effective against squamous cell carcinoma. DL-lactic acid also inhibits mitochondrial membrane potential, which may be one of the mechanisms by which it causes cell death. DL-lactic acid has been found to have antibacterial efficacy against a number of bacteria, including Staphylococcus aureus, Enterococcus faecalis, Escherichia coli, Proteus mirabilis, Pseudomonas aeruginosa, and Streptococcus pyogenes. DL-lactic acid also inhibits enzyme activities that are necessary for bacterial growth such as phosphotransferase enzymes and urease. DL-lactic acid is a metabolic intermediate that can be used to inhibit tumor growth and metastasis. DL-lactic acid also inhibits transcriptional regulation in human serum</p>Formula:C3H6O3Color and Shape:Colorless Clear LiquidMolecular weight:90.08 g/mol4-(Hydroxymethyl)phenylboronic acid
CAS:<p>4-(Hydroxymethyl)phenylboronic acid is an organic compound that has been identified as a reactive, fatty acid. It has shown antibacterial efficacy against gram-positive and gram-negative bacteria in the presence of nanogels. 4-(Hydroxymethyl)phenylboronic acid is also a cross-linking agent that can be used to form hydrogels for tissue engineering applications. This chemical is being studied as a potential treatment for inflammatory bowel disease and diabetes mellitus. 4-(Hydroxymethyl)phenylboronic acid has been shown to have anti-cancer properties by inhibiting the proliferation of cancer cells and inducing apoptosis. The molecule also undergoes structural analysis using confocal microscopy.</p>Formula:C7H9BO3Molecular weight:151.96 g/mol1,4-Piperidinedicarboxylic acid, 4-aMino-, 1-(1,1-diMethylethyl) 4-ethyl ester
CAS:<p>Please enquire for more information about 1,4-Piperidinedicarboxylic acid, 4-aMino-, 1-(1,1-diMethylethyl) 4-ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N2O4Purity:Min. 95%Molecular weight:273.35 g/molEthyl bromodifluoroacetate
CAS:<p>Ethyl bromodifluoroacetate is a chemical substance that reacts with amines in the presence of copper to form a copper complex. It is used as an intermediate in the synthesis of organic compounds, such as pharmaceuticals. Ethyl bromodifluoroacetate is also used as a catalyst for cross-coupling reactions of organic molecules. This reaction requires low energy and can be performed under mild conditions. The asymmetric synthesis of ethyl bromodifluoroacetate requires few steps and only uses inexpensive starting materials. The carbonyl group is chemically stable, making it difficult to decompose or oxidize. However, hydrogen fluoride will react with ethyl bromodifluoroacetate and cause it to decompose into its elements, fluorine and carbon dioxide gas. In addition, nucleophilic attack by halides can lead to the formation of ethyl bromodifluoroacetate from other substances. Control agents are necessary</p>Formula:C4H5BrF2O2Purity:Min. 95%Color and Shape:Colourless LiquidMolecular weight:202.98 g/mol4-Bromocrotonic acid - min 98%
CAS:<p>4-Bromocrotonic acid is a 3-mercaptopropionic acid (3-MPA) derivative. It inhibits the enzyme carnitine acyltransferase, which is involved in the uptake of fatty acids into mitochondria and their subsequent β-oxidation. This leads to an accumulation of fatty acids in the cytosol, which can inhibit insulin-stimulated glucose uptake and protein synthesis. 4-Bromocrotonic acid also inhibits glut1, an amp-activated protein kinase enzyme that plays a key role in cellular metabolism, leading to irreversible inhibition. 4-Bromocrotonic acid is used for analytical purposes as it is a good substrate for mitochondrial enzymes.</p>Formula:C4H5BrO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:164.99 g/mol[2-(4-Aminophenyl)ethyl]carbamic acid tert-butyl ester
CAS:<p>Please enquire for more information about [2-(4-Aminophenyl)ethyl]carbamic acid tert-butyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H20N2O2Purity:Min. 95%Color and Shape:Slightly Yellow PowderMolecular weight:236.31 g/molSpiro[2.3]hexane-1-carboxylic acid
CAS:<p>Please enquire for more information about Spiro[2.3]hexane-1-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H10O2Purity:Min. 95%Molecular weight:126.15 g/mol3-Nitropropionic acid
CAS:<p>3-Nitropropionic acid (3NPA) is a mitochondrial toxin that causes neuronal death by inhibiting complex enzyme activities and inducing reactive oxygen species production. 3NPA also alters mitochondrial membrane potential and induces pro-apoptotic protein expression, leading to neuronal cell death. 3NPA has been shown to be effective in the treatment of experimental models of infectious diseases, such as rat sepsis and human HIV infection, by reducing the number of activated T cells and CD4+ T cells. 3NPA also exhibits anti-inflammatory properties by inhibiting the inflammatory responses of monocytes/macrophages and neutrophils.</p>Formula:C3H5NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:119.08 g/mol(S)-2-Acetoxy-propionic acid
CAS:<p>(S)-2-Acetoxy-propionic acid is a hexyl, enantiopure, and biologically active chemical. It is a pheromone that is secreted by the streptomycetaceae bacterium as part of its mating process. It has been shown to have an inhibitory effect on stingless bees, which are native to Central America and South America. (S)-2-Acetoxy-propionic acid has been found in the mandibular glands of these bees and is believed to play a role in their behavior. This chemical can be synthesized from propionic acid and acetaldehyde or from lactic acid and acetaldehyde. It is also possible to produce it from 2-bromopropanoic acid through the tripropionate pathway. The chemical was first isolated in 1957 by Takaichi Yamashita, who named it for its ability to inhibit bee stings when applied externally. (S)-2-Acetoxy</p>Formula:C5H8O4Purity:Min. 95%Color and Shape:Colorless Clear LiquidMolecular weight:132.11 g/mol2,6-Dichlorophenylacetic acid
CAS:<p>2,6-Dichlorophenylacetic acid is an inhibitor of the enzyme acetylcholinesterase. It has been shown to be effective in a number of functional assays and is efficient at inhibiting the uptake of 2,6-dichlorobenzoic acid in cells. The inhibition of this enzyme by 2,6-dichlorophenylacetic acid may be due to its protonation and binding to the active site. This binding prevents the release of the acetylcholine molecule that has been bound to the enzyme's active site. This results in increased levels of acetylcholine in the synaptic cleft, leading to an increase in neurotransmitter activity, which can have a variety of effects on neuronal function. 2,6-Dichlorophenylacetic acid also inhibits cell proliferation and induces apoptosis (programmed cell death) in Caco-2 cells by inhibiting protein synthesis.</p>Formula:C8H6Cl2O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:205.04 g/mol3-Aminopicolinic acid
CAS:<p>3-Aminopicolinic acid is a carboxylate that can be found in the cytosol, mitochondria, and nucleus of cells. It is an efficient method for the synthesis of picolinic acid from 3-aminopyridine-2-carboxylic acid. The synthesis of picolinic acid has been shown to have structural analogs to molecules involved in nucleotide metabolism such as single-stranded DNA, mitochondrial DNA, and mitochondrial RNA. 3-Aminopicolinic acid has been shown to increase renal blood flow by stabilizing complexes with chloride and phosphoenolpyruvate. This compound also enhances the renal excretion of picolinic acid. 3-Desacetylcefotaxime potassium Tilmicosin Gatifloxacin 3-Aminopicolinic acid</p>Formula:C6H6N2O2Purity:Min. 95 Area-%Color and Shape:Yellow PowderMolecular weight:138.12 g/mol(R)-De(carboxymethoxy) cetirizine acetic acid hydrochloride
CAS:<p>Please enquire for more information about (R)-De(carboxymethoxy) cetirizine acetic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H22Cl2N2O2Purity:Min. 95%Molecular weight:381.3 g/molCobalt(II) acetate tetrahydrate
CAS:<p>Cobalt(II) acetate tetrahydrate is a model system that can be used to study the structures of coordination complexes. The cobalt ion has a coordination geometry with two water molecules, two oxygen atoms from the acetate anion, and one proton from the hydroxide anion. The crystal structure is composed of six-membered rings of alternating metal ions and oxygen atoms. The reaction solution contains excess sodium hydroxide and water vapor. It was determined that cobalt(II) acetate tetrahydrate reacts electrochemically at low frequencies as well as with 5-hmf, an oxidizing agent, in the presence of sodium citrate as an oxidation catalyst.</p>Formula:C4H6CoO4·4H2OPurity:Min. 95%Color and Shape:Pink To Red SolidMolecular weight:249.08 g/molDiethyl 4,4'-Biphenyldicarboxylate
CAS:<p>Diethyl 4,4'-biphenyldicarboxylate is an organic compound that has a chiral center, making it optically active. It is an ester of biphenyl and dicarboxylic acid with the chemical formula CH2=C(CH3)2. The compound has been shown to be a model for other aromatic compounds with similar structures such as phenyl benzoate, which can also form crystals. Diethyl 4,4'-biphenyldicarboxylate is also a mesogen, which means it has liquid crystalline properties and can form thin films. The molecule's conformations are centrosymmetric and its crystal structure is spacer-type centrosymmetric.</p>Formula:C18H18O4Purity:Min. 95%Molecular weight:298.33 g/mol3-(4-Methyl-1,4-diazepan-1-yl)propanoic acid
CAS:<p>Please enquire for more information about 3-(4-Methyl-1,4-diazepan-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H18N2O2Purity:Min. 95%Molecular weight:186.25 g/mol3-(Bromomethyl)benzoic acid
CAS:<p>3-(Bromomethyl)benzoic acid is a quaternary ammonium salt that has been shown to be an ampk activator. It has been used in the synthesis of mesoporous materials and for the synthesis of sulfoxides, oxindoles, and carboxylic acids. 3-(Bromomethyl)benzoic acid has also been used as a calibrant for nonlinear regression analysis, due to its conformational properties.</p>Formula:C8H7BrO2Purity:Min. 95%Molecular weight:215.04 g/molN10-Methyl pteroic acid
CAS:<p>N10-Methyl pteroic acid is a novel immunosuppressant that inhibits T-cell proliferation and promotes regression of inflammatory bowel disease. It has been shown to be effective in treating cancer patients, with the terminal half-life being approximately 20 hours. N10-Methyl pteroic acid is a potent inhibitor of human acute lymphoblastic leukemia cells. It can also be used as an immunosuppressant for organ transplantation, with desorption from gels using matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI TOF MS) and bioanalytical methods such as high performance liquid chromatography (HPLC).</p>Formula:C15H14N6O3Purity:Min. 95%Molecular weight:326.31 g/molMethyl trichloroacetate
CAS:<p>Methyl trichloroacetate (MTCA) is a reactive chemical that is used as an intermediate in the synthesis of various organic compounds. It has been shown to react with nucleophiles, such as hydroxyl groups, to form a copper complex. MTCA has also been found to produce light emission when exposed to air and aryl halides. The synthesis of MTCA involves treating 1-chloro-2-propanol with hydrogen fluoride in the presence of an acid catalyst. The chemical can be detected by gas chromatography or liquid chromatography, but it is not readily available on the market.</p>Formula:C3H3Cl3O2Purity:Min. 95%Molecular weight:177.41 g/mol1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid
CAS:Controlled Product<p>Please enquire for more information about 1-[2-(1H-Indol-3-yl)ethyl]-2,5-dimethyl-1H-pyrrole-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H18N2O2Purity:Min. 95%Molecular weight:282.34 g/mol4-Chlorobutyric acid
CAS:<p>4-Chlorobutyric acid is a fatty acid with the chemical formula CH3ClC(O)CH2CO2H. It can be found in animal fats, vegetable oils, and butter. 4-Chlorobutyric acid has been shown to inhibit the growth of PC12 cells by hydrogen bonding to the cell membrane. This inhibition results in an increase in sodium hydroxide solution activity, which leads to increased production of gamma-aminobutyric acid. The butyrolactone that is produced inhibits nerve function and has been shown to have biological treatment potential for hydrochloric acid and cell culture models.</p>Formula:C4H7ClO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:122.55 g/mol2-Methyl-3-(4-methyl-1H-pyrazol-1-yl)propanoic acid
CAS:Controlled Product<p>Please enquire for more information about 2-Methyl-3-(4-methyl-1H-pyrazol-1-yl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H12N2O2Purity:Min. 95%Molecular weight:168.19 g/molFmoc-(2S,4S)-4-phenylpyrrolidine-2-carboxylic acid
CAS:<p>Please enquire for more information about Fmoc-(2S,4S)-4-phenylpyrrolidine-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H23NO4Purity:Min. 95%Molecular weight:413.47 g/mol(R)-(-)-2-Methylglutaric Acid
CAS:<p>Please enquire for more information about (R)-(-)-2-Methylglutaric Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C6H10O4Purity:Min. 95%Molecular weight:146.14 g/mol4-amino[1,1'-biphenyl]-3-carboxylic acid
CAS:<p>Please enquire for more information about 4-amino[1,1'-biphenyl]-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H11O2NPurity:Min. 95%Molecular weight:213.23 g/mol1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-(tert-Butoxycarbonyl)-4-methylpiperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H21NO4Purity:Min. 95%Molecular weight:243.3 g/mol4-(Difluoromethoxy)phenylboronic acid
CAS:<p>Please enquire for more information about 4-(Difluoromethoxy)phenylboronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H7BF2O3Purity:Min. 95%Molecular weight:187.94 g/mol3-Keto-4-etiocholenic acid methylester
CAS:Controlled Product<p>3-Keto-4-etiocholenic acid methylester is a chemical that has been shown to have insecticidal properties. 3-Keto-4-etiocholenic acid methylester binds to odorant receptors on the antennae of insects and causes an excitatory response. It can be used as a potential environmental pollutant, as well as an insecticide or repellent. 3-Keto-4-etiocholenic acid methylester binds with high affinity to olfactory receptors in the antennae of insects and has been shown to cause excitation when it comes into contact with these receptors. This compound can be used for screening for new materials with similar odorant binding properties, for research purposes, and also as a biosensor for pollution detection. 3-Keto-4-etiocholenic acid methylester has been shown to react with various substances such as oxygen, nitric oxide, nitrous oxide, sulfur dioxide and</p>Formula:C21H30O3Purity:Min. 95%Molecular weight:330.46 g/mol2-(1-Methyl-5-(4-methylbenzoyl)-1H-pyrrol-2-yl)acetic acid
CAS:<p>2-(1-Methyl-5-(4-methylbenzoyl)-1H-pyrrol-2-yl)acetic acid is a nonsteroidal antiinflammatory drug that belongs to the group of drugs called arylpropionic acids. The drug is used to relieve inflammation and pain. 2-(1-Methyl-5-(4-methylbenzoyl)-1H-pyrrol-2-yl)acetic acid has been shown in vitro assays to be toxic to epidermal cells and inhibit the production of inflammatory mediators such as prostaglandins and leukotrienes. The drug also inhibits the production of proinflammatory cytokines such as IL6, IL8, and TNFα by activated human monocytes in vitro. It has been shown to have antiinflammatory activity in experimental models for arthritis, colitis, and asthma.</p>Formula:C15H15NO3Purity:Min. 95%Molecular weight:257.28 g/mol3'-Chloro-biphenyl-4-carboxylic acid
CAS:<p>Please enquire for more information about 3'-Chloro-biphenyl-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate
CAS:<p>Dimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate is a biocompatible polymer that can be used in the treatment of liver injury. It has been shown to have an inhibitory effect on hepatic enzyme activities and synchronous fluorescence. Dimethyl 7,7'-dimethoxy-[4,4'-bibenzo[d][1,3]dioxole]-5,5'-dicarboxylate can be used as a matrix for curcuma aromatica to remove wastewater contaminants. This polymer also has the ability to inhibit monoethyl ether-induced liver injury in low-dose groups and reduce hepatitis B virus replication.</p>Formula:C20H18O10Purity:Min. 95%Molecular weight:418.35 g/mol[(5-Methyl-4-phenyl-4H-1,2,4-triazol-3-yl)thio]acetic acid
CAS:<p>Please enquire for more information about [(5-Methyl-4-phenyl-4H-1,2,4-triazol-3-yl)thio]acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11N3O2SPurity:Min. 95%Molecular weight:249.29 g/molD-Glutamic acid α-amide
CAS:<p>D-Glutamic acid alpha-amide is a carbohydrate that has been shown to have antibiotic properties. It can be produced by chemoenzymatic synthesis and is used as an animal feed additive. D-Glutamic acid alpha-amide is a conjugate of D-glutamic acid with either glycine or beta-alanine. The residue of this compound on red blood cells is measured in order to assess the amount of D-glutamic acid alpha-amide that has been ingested. This compound has also been shown to have antigenic properties, which can elicit immune responses when injected into animals. The meningococcal vaccine that contains D-glutamic acid alpha-amide was found to be effective at stimulating an immune response in mice against meningitis caused by gram negative species, such as Neisseria meningitidis.</p>Formula:C5H10N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:146.14 g/mol3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid
CAS:<p>3,6-Dichlorobenzo[b]thiophene-2-carboxylic acid is an extracellular metabolite that is involved in the metabolism of muscle. It is produced as a byproduct of the reaction catalyzed by dehydrogenase, which converts 3,6-dichlorobenzo[b]thiophene to 2-carboxybenzothiophene. This compound has been shown to inhibit the enzyme histidine carboxylate synthetase, which is involved in branched-chain amino acid synthesis. The enzyme can be inhibited by either a wild type or an analog of 3,6-dichlorobenzo[b]thiophene-2-carboxylic acid.</p>Formula:C9H4Cl2O2SPurity:Min. 95%Molecular weight:247.1 g/mol1-tert-Butyl 3-methyl 1H-indole-1,3-dicarboxylate
CAS:Controlled Product<p>Please enquire for more information about 1-tert-Butyl 3-methyl 1H-indole-1,3-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H17NO4Purity:Min. 95%Molecular weight:275.3 g/mol2-(3-Bromophenyl)propanoic acid
CAS:<p>Please enquire for more information about 2-(3-Bromophenyl)propanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H9BrO2Purity:Min. 95%Molecular weight:229.07 g/mol(E)-8-Methyl-6-nonenoic acid - predominantly trans
CAS:<p>(E)-8-Methyl-6-nonenoic acid is a fatty acid that is found in the acetate extract of Capsicum annuum. It is an analog of the natural compound (E)-8-methyl-6-nonenal, which has been shown to have anticancer properties. The synthesis of this compound has been achieved using a novel approach based on enzymatic reactions and chemical transformations. This compound has been shown to have potential anticancer activity against human prostate cancer cells in vitro and to inhibit the growth of triticum aestivum seeds.</p>Formula:C10H18O2Purity:Min. 95%Molecular weight:170.25 g/mol4-(4-Nitrophenoxy)butanoic acid
CAS:Controlled Product<p>Please enquire for more information about 4-(4-Nitrophenoxy)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H11NO5Purity:Min. 95%Molecular weight:225.2 g/molTetrakis[N-phthaloyl-(S)-phenylalaninato]dirhodium Ethyl Acetate Adduct
CAS:<p>Please enquire for more information about Tetrakis[N-phthaloyl-(S)-phenylalaninato]dirhodium Ethyl Acetate Adduct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C68H48N4O16Rh2·C4H8O2Purity:Min. 95%Molecular weight:1,471.04 g/mol(1R)-(-)-Menthyl acetate
CAS:<p>(1R)-(-)-Menthyl acetate is a lipase that catalyzes the hydrolysis of esters and amides. It has been immobilized to produce a solid-state biocatalyst that is efficient for the hydrolysis of ester bonds. Candida is an unicellular eukaryotic organism belonging to the phylum Ascomycota, class Saccharomycetes. The enzyme has shown excellent activity against Candida albicans, which causes candidiasis.</p>Formula:C12H22O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:198.3 g/molTimapiprant
CAS:Controlled Product<p>Timapiprant is an amide that acts as a selective inhibitor of the prostanoid receptor CRTH2, which is involved in regulating the inflammatory response. Timapiprant inhibits skin eosinophilia, which is associated with inflammatory skin diseases such as atopic dermatitis and psoriasis. It has been shown to be safe in clinical trials and has a good safety profile. The drug's mechanism of action may be due to its ability to inhibit the production of IL-4 and IL-13 by Th2 cells and its ability to inhibit lung function. Timapiprant has shown efficacy in treating allergic rhinitis, asthma, chronic obstructive pulmonary disease, erythema multiforme, pyoderma gangrenosum, and other types of inflammatory skin diseases.</p>Formula:C21H17FN2O2Purity:Min. 95%Molecular weight:348.37 g/molrac 5-Hydroxy valproic acid sodium
CAS:<p>Please enquire for more information about rac 5-Hydroxy valproic acid sodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H16O3•NaPurity:Min. 95%Color and Shape:PowderMolecular weight:183.2 g/molD-Aspartic acid b tert-butyl ester
CAS:<p>D-Aspartic acid b tert-butyl ester (DATB) is an antimicrobial agent that has been shown to inhibit the growth of drug-resistant bacteria. DATB has been shown to be active against both gram-positive and gram-negative bacteria, with a selectivity for those with a peptidoglycan cell wall. DATB inhibits the synthesis of amide and peptide bonds and has been shown to have a wide range of uses in the production of antibiotics, such as carbamates and natural products.</p>Formula:C8H15NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:189.21 g/molMethyl 4-hydroxy-1-benzofuran-6-carboxylate
CAS:<p>Please enquire for more information about Methyl 4-hydroxy-1-benzofuran-6-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H8O4Purity:Min. 95%Molecular weight:192.17 g/mol2-Methoxypyrimidine-5-boronic acid
CAS:<p>Please enquire for more information about 2-Methoxypyrimidine-5-boronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C5H7BN2O3Purity:Min. 95%Molecular weight:153.93 g/molEthylcyclobutanecarboxylate
CAS:<p>Ethylcyclobutanecarboxylate is an organic compound that is used as a drug for the treatment of cancer. It has been shown to inhibit cholesterol ester transfer and has been used in the treatment of pancreatitis, autoimmune diseases, dyslipoproteinemia, and inflammatory diseases. This drug has been shown to reduce insulin resistance and can be used as a treatment for diabetes-associated complications. Ethylcyclobutanecarboxylate is also metabolized into a pharmacologically active form by cb2 receptor. The biological samples that have been studied include plasma and urine; however, it can also be detected in other types of tissue such as brain, stomach, and kidney.</p>Formula:C7H12O2Purity:Min. 95%Molecular weight:128.17 g/mol2-Methoxy-4-amino-5-ethylthiobenzoic acid
CAS:<p>Please enquire for more information about 2-Methoxy-4-amino-5-ethylthiobenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H13NO3SPurity:Min. 95%Molecular weight:227.28 g/molMethyl 2-cyclohexyl-2-hydroxyphenylacetate
CAS:<p>Methyl 2-cyclohexyl-2-hydroxyphenylacetate is a c6 alkyl and diode. It is an orally active hormone with potential use in catalysis of additives, as well as in the treatment of metabolic disorders. Methyl 2-cyclohexyl-2-hydroxyphenylacetate has been shown to have anticholinergic properties, which may be due to its ability to inhibit acetylcholine release from nerve endings. Lectins are proteins found on the surface of cells that bind to specific sugars and play a role in many biological processes. A lectin that binds to erythrocytes can be used as a marker for damaged red blood cells. Methyl 2-cyclohexyl-2-hydroxyphenylacetate has been shown to react with this lectin in plasma samples from humans, indicating that it is metabolized by enzymes present in red blood cells.</p>Formula:C15H20O3Purity:Min. 95%Molecular weight:248.32 g/mol3,5-difluoro-4-formylbenzoic Acid
CAS:<p>3,5-Difluoro-4-formylbenzoic acid is a sulfamic acid derivative that is used as a catalyst in the synthesis of aldehydes. The catalytic activity of 3,5-difluoro-4-formylbenzoic acid is due to its ability to be oxidized by air and light to give an active form. It also has other uses in the synthesis of dihydropyrans and regioselectivity studies.</p>Formula:C8H4F2O3Purity:Min. 95%Molecular weight:186.11 g/mol1,1'-Bicyclo[1,1,1]pentane-1,3-dicarboxylic acid monomethyl ester
CAS:<p>1,1'-Bicyclo[1,1,1]pentane-1,3-dicarboxylic acid monomethyl ester is a chemical compound used in research and as a building block for complex compounds. It is a high quality and versatile compound that has a wide range of uses in the production of fine chemicals. This compound is an intermediate for the synthesis of 1,4-benzodioxan. CAS No. 83249-10-9</p>Formula:C8H10O4Purity:Min. 95%Color and Shape:White PowderMolecular weight:170.16 g/mol3-Cyanopropionic acid methyl ester
CAS:<p>3-Cyanopropionic acid methyl ester is a compound that belongs to the class of aliphatic carboxylic acids. It is an intermediate in the production of adiponitrile and acrylonitrile. This compound is used as a feedstock for the manufacture of vinylene, which can be used to produce c1-6 alkyl. 3-Cyanopropionic acid methyl ester can be produced from propylene and hydrogen cyanide in a high salt, activated reaction system. It has been shown that this compound may have metabolic disorders due to its ability to inhibit fatty acid oxidation and increase viscosity. 3-Cyanopropionic acid methyl ester is a colorless liquid at room temperature with a boiling point of 154°C and a molecular weight of 98.14 g/mol.</p>Formula:C5H7NO2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:113.11 g/mol3-Chloro-4-methoxyphenylboronic acid
CAS:<p>Please enquire for more information about 3-Chloro-4-methoxyphenylboronic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C7H8BClO3Purity:Min. 95%Molecular weight:186.4 g/mol(5-Fluoro-2-methyl-1H-inden-3-yl)acetic acid
CAS:<p>(5-Fluoro-2-methyl-1H-inden-3-yl)acetic acid (FMIAA) is a phase transfer catalyst that catalyses the condensation of alkyl esters. It can be used in the condensation of aromatic and aliphatic aldehydes in liquid phase with potassium as a reagent and organic solvent. The FMIAA is then removed by dehydrating the product, leaving it in solid form. FMIAA has been shown to be effective for the synthesis of a wide range of compounds, including pharmaceuticals such as cyclopentanone, aminomethylpiperidine, and 4-aminoquinoline.</p>Formula:C12H11FO2Purity:Min. 95%Molecular weight:206.21 g/mol3-Cyanoethylbenzoic acid
CAS:<p>3-Cyanoethylbenzoic acid is an anthropogenic compound that is produced by the Friedel-Crafts reaction between benzoyl chloride and acrylonitrile in the presence of a base. 3-Cyanoethylbenzoic acid is used as a solvent for chromatographic methods, such as gradient elution, ion exchange, and reversed phase. 3-Cyanoethylbenzoic acid has been used to determine the optical purity of benzoate salts and amides. This compound can be taken orally in solid oral dosage form or enterically in liquid oral dosage form. 3-Cyanoethylbenzoic acid interacts with other drugs that are metabolized by CYP3A4, such as erythromycin, to produce an active metabolite (N-desmethyldesipramide).</p>Formula:C10H9NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:175.18 g/mol4-Diazobenzenesulfonic Acid
CAS:<p>Applications 4-Diazobenzenesulfonic acid (cas# 305-80-6) is a useful research chemical.<br></p>Formula:C6H4N2O3SMolecular weight:184.17Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid
CAS:<p>Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Boc-15-amino-4,7,10,13-tetraoxapentadecanoic acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C16H31NO8Purity:Min. 95%Molecular weight:365.42 g/mol3-Benzoyl acrylic acid
CAS:<p>3-Benzoyl acrylic acid is an organic compound that is the product of a chemical reaction between benzaldehyde and acetic anhydride. It contains a carboxylic acid group, an hydroxyl group, a nitro group, and a particle. 3-Benzoyl acrylic acid has been shown to inhibit the growth factor epidermal growth factor (EGF). This inhibition occurs by binding to the receptor for EGF on the cell membrane and blocking its activation. 3-Benzoyl acrylic acid also inhibits fatty acid synthesis and mitochondrial membrane potential, which may be due to its ability to form ester hydrochloride.</p>Formula:C10H8O3Purity:Min. 95%Color and Shape:PowderMolecular weight:176.17 g/molDimethyl benzyl carbinol acetate
CAS:<p>Dimethyl benzyl carbinol acetate is a polymer that forms a film on the skin and prevents water loss. It has been shown to have enzyme-inhibiting properties, which may be due to its ability to prevent geranyl production. Dimethyl benzyl carbinol acetate has also been used as a sealant in microcapsules, which are then broken down by enzymes in order to release the contents of the capsule. Dimethyl benzyl carbinol acetate can also be used as an antimicrobial agent, where it inhibits bacterial cell growth by interfering with fatty acid synthesis.</p>Purity:Min. 95%(4-Chloro-3-fluorophenyl)acetic acid ethyl ester
CAS:<p>Please enquire for more information about (4-Chloro-3-fluorophenyl)acetic acid ethyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H10ClFO2Purity:Min. 95%Molecular weight:216.64 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/molSilver(I) 2,2,2-trifluoroacetate
CAS:<p>Silver trifluoroacetate is a chemical compound that is a silver salt of trifluoroacetic acid. Silver trifluoroacetate is a white crystalline solid, soluble in water and alcohols, but insoluble in ethers. It has the chemical formula AgCF3CO2H. The crystal structure of silver trifluoroacetate has been determined by x-ray diffraction techniques and found to be orthorhombic with space group Pbam. The molecule consists of two 5-membered heteroaromatic rings, one containing carbon atoms and the other containing nitrogen atoms. The nitrogen atom is bonded to six hydrogen atoms and three fluorine atoms, while the carbon atom is bonded to four oxygen atoms and one fluorine atom. Synthesis methods for this compound include reacting silver nitrate with sodium carbonate in water vapor at 120°C.</p>Formula:C2AgF3O2Purity:Min. 95%Molecular weight:220.88 g/molNeuronostatin-13 (mouse, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuronostatin-13 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H112N20O17Purity:Min. 95%Molecular weight:1,445.71 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/molpTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about pTH-Related Protein (1-37) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C197H317N63O53Purity:Min. 95%Molecular weight:4,416.02 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molAntifreeze Polypeptide 6 (winter flounder) trifluoroacetate salt
CAS:<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>Formula:C133H225N43O51•xC2HF3O2Purity:Min. 95%Molecular weight:3,242.47 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C98H132N20O20S4Purity:Min. 95%Molecular weight:2,038.48 g/mol5-FAM-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about 5-FAM-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C188H282N52O59S2Purity:Min. 95%Molecular weight:4,278.7 g/mol(D-Trp6)-LHRH (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H81N17O14Purity:Min. 95%Molecular weight:1,312.43 g/molEthyl-2-ethoxy-1-[[(2'-cyanobiphenyl-4-yl) methyl] benzimidazole-7-carboxylate
CAS:<p>Candesartan is a selective angiotensin II receptor antagonist that inhibits the binding of angiotensin II to its receptors, which in turn decreases the activity of angiotensin-converting enzyme. Candesartan cilexetil is an ester prodrug that has been shown to be effective in the treatment of high blood pressure. In the crystalline form, candesartan cilexetil is a white powder with a melting point of 130–135 °C and a solubility in water of >1 g/L. The molecular weight of candesartan cilexetil is 393.8 g/mol and it has a molecular formula C17H21NO2S. The chemical structure consists of two benzimidazole rings coupled together through an ethyl-2-ethoxy linker and attached to a carboxylate group on one end and an amide group on the other</p>Formula:C26H23N3O3Purity:Min. 95%Molecular weight:425.48 g/molPAR-2 (6-1) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.82 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C93H143N25O24Purity:Min. 95%Molecular weight:1,995.28 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.67 g/molTRAP-6 ammonium acetate salt
CAS:<p>TRAP-6 is a biocompatible polymer that is used to prevent adhesion of platelets to the endothelium and activation of coagulation. TRAP-6 has been shown to be effective in preventing inflammatory bowel disease, as well as other bowel diseases, by inhibiting the release of inflammatory cytokines such as fibrinogen and erythropoietin. This drug has been shown to have clinical relevance in treating inflammatory bowel disease in animal models. TRAP-6 can also be used to inhibit the growth of bacteria by binding to bacterial cells or by inducing their death. In addition, TRAP-6 can bind with monoclonal antibodies and target specific cells for destruction.</p>Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molCART (55-102) (human) trifluoroacetate salt
CAS:<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>Formula:C225H365N65O65S7Purity:Min. 95%Molecular weight:5,245.17 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C99H153N29O26S5Purity:Min. 95%Molecular weight:2,325.78 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C191H291N53O56SPurity:Min. 95%Molecular weight:4,257.74 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H78N14O11Purity:Min. 95%Molecular weight:1,111.3 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O13·xC2HF3O2Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:1,253.41 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/mol

