Carboxylic Acids

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Ethylpyridine-2-carboxylic acid is a biologically active compound that is biosynthesized from the amino acid tryptophan. This compound is also known as 5-ethylpicolinic acid or 5-ethylpyridin-2-yl carboxylic acid. It is a phytoalexin, which is an antimicrobial agent produced by plants to inhibit pathogen growth. 5-Ethylpyridine-2-carboxylic acid has been shown to be effective against picolinic acid phosphoribosyltransferase and flavopereirine reductase in vitro, and has also been shown to have antimicrobial properties against Escherichia coli, Staphylococcus aureus, and Bacillus cereus. 5-Ethylpyridine-2-carboxylic acid can be prepared by reacting ethyl acetoacetate with pyridine</p>

<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(Bromomethyl)phenylacetic acid is a potent cancer drug that blocks the activity of hydrogen-bonding interactions. It inhibits the growth of prostate cancer cells, DU145 cells, and other cell lines. The drug has been shown to inhibit the activation of toll-like receptor 4 (TLR4) in primary blood cells from healthy donors. TLR4 is a protein found on the surface of immune cells that senses molecules from bacteria, fungi, parasites, and viruses. This protein plays an important role in triggering anti-inflammatory and pro-inflammatory responses to infection. The drug also inhibits platelet aggregation and lipoprotein lipase activity in vitro.</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt is a recombinant, fluorescent, hydrazide, labile protein that has been synthesized with a murine amino acid sequence. This protein has been shown to be reactive with the cytokine IL2 and can be used for labeling of cells or proteins in cytometric analysis. The N-terminal end of this protein is acidic, allowing for it to react with periodate or hydroxylamine for tagging purposes.</p>

<p>Benzimidazole-5-carboxylic acid is a monoclonal antibody that binds to the amide group of an amino acid. It has been shown to be a potent inhibitor of cell growth in cervical cancer cells and rat liver microsomes. It also showed inhibitory activity against fatty acid and nucleotide synthesis. Benzimidazole-5-carboxylic acid is a benzimidazole compound that has been shown to have anti-inflammatory effects in animal models and also inhibits the replication of HIV. This drug can inhibit the replication of influenza A virus in vitro and may be useful as an antiviral agent for treatment of influenza A infection.</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a synthetic peptide that is a potent and selective antagonist of the NMDA receptor. Neurokinin B trifluoroacetate salt H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met NH2 trifluoroacetate salt has been shown to be effective in animal models of chronic pain, neuropathic pain, and bone age delay. This synthetic peptide has also been shown to be effective in the treatment of squamous cell carcinoma and acid lesions in human subjects. The molecular weight of this compound is 624.6 g/mol.br&gt;<br>Neurokinin B trifluoroacetate salt H Asp Met His Asp P</p>

<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Pyridylboronic acid pinacol ester is a versatile reagent that can be used in the synthesis of polymers with reactive functionalities. This compound is a crosslinker, which means that it reacts with two or more other molecules to form a covalent bond. 3-Pyridylboronic acid pinacol ester has been shown to react with ring-opening methacrylate monomers and expand their polymer backbone, which leads to an increase in the number of reactive groups on the chain. The introduction of 3-pyridylboronic acid pinacol ester can also introduce fluorescent units into polymers for use as probes for biological systems. There are many possible applications for this versatile reagent, including its use in the synthesis of imidazopyridine ligands.</p>

<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TLQP-21 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Di-tert-butyl azodicarboxylate (DTBA) is an organic compound that is used in organic synthesis as a dienophile. DTBA reacts with various electrophiles to form dihydro derivatives through a transfer mechanism, which can be monitored by the change in magnetic resonance spectroscopy signals. The reaction of DTBA with trifluoroacetic acid and hydrogen chloride forms the desired product, 3-amino-2,4,6-trichloropyridine. DTBA is also used for the synthesis of 1,4-dihydropyridines from 2-aminobenzene derivatives and bromoacetaldehyde diethyl acetal. This process is catalyzed by palladium on carbon. DTBA is asymmetric at position C5 and C6 because it has two chiral centers: one at C3 and one at C5 or C6. The use of this reagent allows for the scalable</p>

<p>(D-Arg2)-Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt is a peptide that contains two amino acid residues, D-arginine and L-tyrosine. It has been shown to have analgesic properties in animal models of pain, and is also thought to be involved with bowel disease, congestive heart failure, and platelet aggregation. The biological activity of this peptide has been studied using whole cell recordings in the presence of an experimental model (rat dorsal root ganglion neurons). Kyotorphin acetate salt H-Tyr-D-Arg-OH acetate salt was found to inhibit enzyme activities such as cyclase and phosphodiesterase. This peptide binds to opioid receptors and acts as an electrochemical detector for cyclases, which are enzymes that produce cyclic adenosine monophosphate (cAMP). Kyotorphin acetate salt H-Tyr-D</p>

<p>2-Hydrazinobenzoic acid hydrochloride is a synthetic compound that can be used as a ligand or substrate for the polymerase. It has been shown to interact with the NS5B polymerase, which is involved in viral replication and drug resistance. 2-Hydrazinobenzoic acid hydrochloride also produces reduction products and luminescence when combined with chloride. The luminescence is thought to be due to an interaction with the nucleophilic carbonyl group of 2-hydrazinobenzoic acid hydrochloride and a nucleophilic attack on the carbonyl oxygen atom by chloride ions. This reaction produces blue light at around 470 nm.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of afatinib</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Nle-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-[3-(S)-[3-(2-(7-Chloro-2-quinolinyl)ethenyl)phenyl]-3-hydroxypropyl]benzoic acid methyl ester is a synthetic compound that can be used as a reagent in the synthesis of polynucleotides and polypeptides. It can also be used as an inhibitor of ketoreductase, which is an enzyme involved in the synthesis of fatty acids and ketones. 2-[3-(S)-[3-(2-(7-Chloro-2-quinolinyl)ethenyl)phenyl]-3-hydroxypropyl]benzoic acid methyl ester has been shown to inhibit the growth of wild type and mutant strains of E. coli. The molecular weight of this compound is 439.</p>

<p>3,4,5-Trimethoxybenzoic acid anhydride is a synthetic chemical compound that is used as a pharmaceutical intermediate. It is mainly used to prepare potent anticancer agents and potent anticancer drugs. 3,4,5-Trimethoxybenzoic acid anhydride reacts with amines in the presence of a base to form substituted amides. This reaction has been shown by crystal x-ray diffraction to be sensitive to the solvent polarity and temperature of the reaction medium. The compound can also react with chloride ion to form 3,4,5-trichlorobenzoic acid anhydride (3TCBA).</p>

<p>Oleic acid is a naturally occurring monounsaturated fatty acid (C18:1, cis-9-octadecenoic acid) widely used as an excipient in pharmaceutical formulations. Due to its amphiphilic and lipophilic properties, oleic acid is an important drug excipient primarily used to enhance the solubility and bioavailability of poorly water-soluble drugs. As a fatty acid, it is widely used in cosmeceuticals as it acts as a solubilizer in lipid-based systems, an emulsifier in creams and ointments, and a penetration enhancer in transdermal patches, aiding drug absorption through the skin.</p>

<p>5-Amino-2-methoxyisonicotinic acid is a carboxylic acid that is used in the synthesis of aminopyridines. The compound can be synthesized from formamidine acetate and diethyl dicarbonate. This process involves lithiation, followed by addition of an amine and finally conversion to the desired product with formamidine acetate. 5-Amino-2-methoxyisonicotinic acid can also be synthesized from formamide and diethyl ether. 5-Amino-2-methoxyisonicotinic acid is an analog of 2,4,6-trimethylaniline and has been shown to have similar properties to this compound, including strong basicity.</p>

<p>Please enquire for more information about Z-Leu-Arg-Gly-Gly-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt is a potent inhibitor of the enzyme kallikrein, which is involved in the production of kinins. It has been shown to inhibit bradykinin breakdown by inhibiting kallikrein and thus prolonging the effects of this hormone. Cyclohexylacetyl-Phe-Arg-Ser-Val-Gln-NH2 trifluoroacetate salt also inhibits aldosterone levels in plasma and reduces glucocorticoid levels, which may be due to its ability to inhibit plasma renin concentrations.</p>

<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cell-permeable Caspase-3 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>L-Lysine acetate is a precursor of L-lysine and is used in the treatment of cancers. It has been shown to promote the growth of pluripotent cells, which can differentiate into any tissue type. L-Lysine acetate promotes cellular transformation by increasing the expression of growth factor-β1 in cells. This compound also enhances cellular physiology, energy metabolism, and protein degradation. L-Lysine acetate inhibits the ubiquitin ligases that are involved in protein degradation, leading to an increase in cell proliferation. The use of L-Lysine acetate has shown promising results for the treatment of infectious diseases such as HIV/AIDS and tuberculosis. L-Lysine acetate blocks the replication of human immunodeficiency virus (HIV) by inhibiting reverse transcriptase activity and blocking its DNA chain elongation process.</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4,4'-Dichlorodiphenylsulfone-3,3'-disulfonic acid disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3-Bromo-6-methylpicolinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuronostatin-13 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br&gt;br&gt;<br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>2,7-Naphthalenedicarboxylic acid is a synthetic compound that belongs to the group of aromatic hydrocarbons. It has been shown to have magnetic resonance spectroscopy (MRS) and X-ray structures that are similar to those of phenyl substituents. 2,7-Naphthalenedicarboxylic acid also shows supramolecular interactions with other molecules. The asymmetry can be explained by the presence of a nitrogen atom in the molecule, which can form intramolecular hydrogen bonds.</p>

<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Nociceptin trifluoroacetate salt is an opioid with low potency that is used in the treatment of pain. It has been shown to bind to the protein and inhibit protease, which has been proposed as a possible mechanism for its analgesic effects. Nociceptin trifluoroacetate salt may also have indirect effects on brain functions by regulating levels of nociceptin, a neuropeptide that interacts with nociceptive neurons in the brain. This drug has been shown to have nootropic effects in mice, including increased locomotor activity and improved memory retention. Nociceptin trifluoroacetate salt inhibits kappa-opioid receptors and is therefore used as a pharmacological tool for research into opioid receptor function.</p>

<p>Please enquire for more information about (Des-Gly10,D-Trp3,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Proadrenomedullin (1-20) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2,2-Difluoro-1,3-Benzodioxol-5-Ylboronic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (S)-(1-boc-pyrrolidin-3-yl)-acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>5-Bromo-2-fluorobenzoic acid is a potential drug that can be used to treat diseases such as malaria. It is also used in the synthesis of fluorine compounds, such as fluoroarenes. 5-Bromo-2-fluorobenzoic acid is activated by deprotonation with butyllithium and reacts with chlorine to give the product of 5-bromo-2-chlorobenzoic acid. The reagent chlorotrimethylsilane may also be used for this reaction. Substitution of fluorine for chlorine at the 2 position yields the desired product, 5-bromo-2-(trifluoromethyl)benzoic acid. This compound is a useful intermediate for making other drugs, including those that are important for treating cancer and viral infections.</p>

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>

<p>Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt is a peptide hormone that regulates blood pressure by causing the kidneys to excrete sodium and water. It is used as a model system for studying the physiological effects of urodilatin and has been shown to inhibit the cyclase enzyme. Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) trifluoroacetate salt may also have an antihypertensive effect through its ability to reduce levels of natriuretic peptides in plasma. This drug is also being investigated as a possible treatment for congestive heart failure. The small molecular weight makes it suitable for use as a natriuretic or antihypertensive drug with minimal side effects.</p>

<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>

<p>3-Amino-4-hydroxybenzoic acid hydrochloride (3ABA) is a crystalline compound with a molecular formula of C6H5NO2. It is an acidic compound that is soluble in water and alcohol, but not in ether. 3ABA has been used as the starting material for the synthesis of many other organic compounds. It can be obtained by reacting phenol with chlorobenzoyl chloride to form the chlorobenzoate salt, which on hydrolysis yields 3ABA. This compound has also been used as a reagent for synthesizing carbon nanotubes. The crystal structure of 3ABA was determined using X-ray diffraction data from crystallographic studies, and it was found to have three independent molecules per unit cell. Diffraction indicated that each molecule is composed of two benzene rings joined by a single bond between carbon atoms 1 and 2 and another bond between carbon atoms 2 and 3.</p>

<p>Pyrrole-2-carboxylic acid is a polycyclic aromatic compound that can be found in coal tar. It has been shown to have anti-inflammatory, antiallergic, and antifungal properties. Pyrrole-2-carboxylic acid is produced by the human body as an intermediate in the metabolism of tryptophan. This compound can also be synthesized and used to treat chronic bronchitis, which is caused by excessive mucus production and inflammation of the airways. The reaction mechanism for pyrrole-2-carboxylic acid is similar to that of other drugs that are used in respiratory therapy, such as aminophylline or acetylcysteine.</p>

<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about O-Hippuryl-L-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 6-oxo-1,6-dihydropyridazine-3-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Intermedin-53 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr1)-TRAP-7 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>