Carboxylic Acids

<p>The trifluorophenylboronic acid is a boronic acid that has been used in the synthesis of vitamin B12. This compound is often used as a catalyst for the Suzuki coupling reaction. It can also be used to synthesize amides and synthons. The trifluorophenylboronic acid is soluble in water, ethanol, and acetone. The pH of the solution depends on the type of base added. For example, when an amine is added to the solution, it increases to approximately 8-9. When a p-hydroxybenzoic acid is added to the solution, it decreases to approximately 2-3.</p>

<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (2-38) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Used in treatment of nonspecific ulcerative colitis</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (2-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>

<p>Please enquire for more information about Galanin-Like Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sarafotoxin C is a peptide from the venom of the spider Phoneutria nigriventer that has been shown to have potent inhibitory properties on endothelin-1. Sarafotoxin C is able to block intracellular Ca2+ levels and signal pathways, leading to decreased levels of endothelin-1 as well as other inflammatory mediators. Sarafotoxin C has also been shown to have an anti-inflammatory effect in bowel disease, which may be due to its ability to inhibit the production of cytokines and prostaglandins. The biological properties of sarafotoxin C are related to its inhibition of polymerase chain reaction (PCR) amplification of DNA. This inhibition is due to the binding of sarafotoxin C with endothelin receptors on DNA, which prevents DNA polymerase from attaching. Endothelin-a receptor activity can also be inhibited by sarafotoxin C through enzymatic inactivation. Sarafot</p>

<p>Please enquire for more information about Met-Enkephalin-Arg acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rhodanine-N-acetic acid is a model system for antimicrobial agents. It is an acidic molecule with low light absorption and can be used as a chemotherapeutic agent. Rhodanine-N-acetic acid has been shown to have high resistance to bacteria in vitro, making it effective against malonic acid, which is the main cause of infection. Rhodanine-N-acetic acid has been shown to have biological properties, such as photophysical and redox potentials that make it suitable for use in vivo. Rhodanine-N-acetic acid also has photocurrent and electrochemical impedance spectroscopy characteristics that may be used to measure its activity in vivo.</p>

<p>Please enquire for more information about TIMP-2 (145-168) (human, bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pyr 1)-Opiorphin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5'-Chloro-2'-hydroxy-3'-nitro-[1,1'-biphenyl]-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Phe12, Nle 21·38)-CRF (12-41) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-ACTH (4-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl 2-amino-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methoxy-6-picolinic acid (2MPA) is a picolinate that has been shown to be an effective catalyst for the conversion of alcohols into allylic alcohols. 2MPA is able to catalyze the reaction by abstracting hydrogen from the carbonyl group, and then adding it to the adjacent carbon. This reaction can produce peroxide as a byproduct, which is subsequently hydrolyzed to form water and alcohol. The β-unsaturated carbonyl group of 2MPA provides additional stability for this catalytic process.<br>2MPA can also be used as a catalyst in other reactions, such as the oxidation of benzylic alcohols with hydrogen peroxide to form benzylic carbonyl compounds.</p>

<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>

<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.</p>

<p>Please enquire for more information about Z-Arg-Arg-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid is a benzene ring with a carboxylic acid group. It has the ability to modify polylactic acid, polycarbonate, and other polymers. The chain can be modified to include amino groups or antibacterial groups. (S)-N-Carbobenzyloxy-4-amino-2-hydroxybutyric acid also has antibacterial properties and is compatible with polylactic acid, which makes it ideal for use in polymer modifications.</p>

<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>

<p>Please enquire for more information about (DL-Isoser 1)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Sulfamylbenzoic acid is a model system for the study of transporter and receptor activity. It has been shown to have the ability to inhibit tubule cells in carcinoma cell lines by binding to the protein target, nitrogen atoms, and hydrophobic effect. 4-Sulfamylbenzoic acid has also been shown to bind to the drug transporter and receptor activity. This binding prevents the formation of an inhibitor-transmitter complex with the enzyme that is required for transport or receptor activity, as well as inhibiting protein synthesis and cell division. The kinetic and reaction mechanism are not known at this time.</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,3,6,8-Pyrenetetrasulfonic acid tetrasodium salt (PTS) is a palladium complex that is used as a catalyst in the chemical industry. It can be prepared by the reaction of palladium chloride with sodium sulfide and sodium hydroxide. PTS has been shown to react with diethyl succinate, forming a solid catalyst that can be stored for longer periods of time. This compound has been found to catalyze hydrogenations under constant pressure conditions and also exhibit low energy consumption when performing reactions. PTS is able to bind to DNA, leading to cancer cell death. PTS also has fluorescence properties and can be used in electrochemical impedance spectroscopy.</p>

<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>

<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Nitrobenzaldiacetate is a crystalline solid that can be obtained by two-dimensional experimental methods. It has been shown to have high reactivity in the presence of ozone and sulfuric acid. The reaction product is the corresponding sulfate salt. The filtration technique is used to separate the desired product from the reaction mixture. This product can also be crystallized with catalytic amounts of sulfuric acid and 4-nitrobenzoic acid. The catalytic oxidation of 4-nitrobenzoic acid to form 4-nitrobenzaldaicetic acid, as well as its subsequent conversion to 4-nitrobenzaldiacetate, are both feasible reactions for this compound.</p>

<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>

<p>Hexanedioic acid is a glycol ether that is used as an extraction solvent. It has been shown to be a good solvent for the separation of organic acids and aromatic compounds, such as malonic acid and caproic acid. Hexanedioic acid has also been shown to be a good solvent for the removal of sulfur and nitrogen compounds from water vapor. Hexanedioic acid can also be used as an oxidation catalyst in the chemical industry. Hexanedioic acid is stable in acidic and alkaline environments, but not in basic environments.</p>

<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr9)-beta-MSH (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-Leu-Arg-Phe-NH2 acetate salt is a peptide that has been shown to inhibit neuronal activity in the Xenopus oocyte. This inhibition is biphasic and can be reversed by the addition of an excess of glutamate. It has been shown to have an inhibitory effect on the release of neurotransmitters from the isolated heart, ganglia, and subesophageal ganglion. The sequence of H-Phe-Leu-Arg-Phe-NH2 acetate salt has been determined as carboxy terminal. The physiological effects of H-Phe-Leu-Arg-Phe-NH2 acetate salt are related to its receptor binding properties.</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Benzopyrazine-6-boronic acidHCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>Please enquire for more information about Dnp-(Leu421)-Collagen Type VIII a1 Chain (419-426) amide (human, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is a reagent that is used as a reactant in organic synthesis. It is also useful as a scaffold for the synthesis of heterocycles and other complex compounds. 3-(3,5-Dimethoxyphenyl)propionic acid methyl ester is used in research chemical synthesis and as a versatile building block for the production of fine chemicals. This chemical can be used to create products such as pharmaceuticals, pesticides, and cosmetics.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>