
Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12454 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
2-Chloro-3,4-dihydroxybenzoic acid
CAS:<p>Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.</p>Formula:C7H5ClO4Purity:Min. 95%Color and Shape:White To Yellow To Light Brown SolidMolecular weight:188.56 g/mol(Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys47)-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C58H114N32O13SPurity:Min. 95%Molecular weight:1,499.8 g/molAnthranilyl-HIV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H65N13O11Purity:Min. 95%Molecular weight:940.06 g/molTri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate
CAS:<p>Tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate is a molecule that has been used in the diagnosis of cervical cancer. This drug binds to the metal chelator and is then attached to a water molecule by the functional group. This process makes the compound more stable and prevents it from reacting with other molecules. The cyclic peptide is then attached to the tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate molecule which can be detected by an MRI scan.</p>Formula:C26H50N4O6Purity:Min. 95%Molecular weight:514.7 g/molEpsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt
CAS:<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>Formula:C16H15N2NaO9SPurity:Min. 95%Molecular weight:434.35 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molH-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt is a peptide that binds to the α5β1 integrin receptor. It has been shown to inhibit the growth of carcinoma cell lines and induce apoptosis in tumor cells by binding to receptors on the surface of cancer cells. H-Gly-Arg-Ala-Asp-Ser-Pro-OH trifluoroacetate salt has also been shown to be effective against damaged tissue, such as adhesions, and promote wound healing by stimulating collagen production. This agent also has genotoxic effects and can cause DNA damage. H-Gly-Arg-Ala-Asp-Ser-Pro -OH trifluoroacetate salt may also have an antiapoptotic effect through its ability to bind with basic proteins, proapoptotic proteins, and epidermal growth factor receptor.</p>Formula:C23H39N9O10Purity:Min. 95%Molecular weight:601.61 g/molNeuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Formula:C90H132N26O25Purity:Min. 95%Molecular weight:1,978.17 g/molMyelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (85-99) Peptide Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C70H114N18O21Purity:Min. 95%Molecular weight:1,543.76 g/molKyotorphin acetate salt
CAS:<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4Purity:Min. 95%Molecular weight:337.37 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/mol(Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Beta-Asp3)-VIP (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H238N44O42SPurity:Min. 95%Molecular weight:3,325.8 g/molH-Pro-Lys-OH acetate salt
CAS:<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>Formula:C11H21N3O3Purity:Min. 95%Molecular weight:243.3 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Formula:C6H8BNO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:136.94 g/mol4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid
CAS:<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>Formula:C13H18N2O2Purity:Min. 95%Molecular weight:234.29 g/mol(Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt
<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C134H180N34O26S2Purity:Min. 95%Molecular weight:2,747.21 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:<p>Intermediate in the synthesis of tedizolid</p>Formula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molGalnon trifluoroacetate salt
CAS:<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>Formula:C40H46N4O6Purity:Min. 95%Molecular weight:678.82 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/molXenopsin-Related Peptide 1 (XP-1) trifluoroacetate salt
CAS:<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>Formula:C51H79N15O9Purity:Min. 95%Molecular weight:1,046.27 g/molPalmitoleic acid methyl ester
CAS:<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>Formula:C17H32O2Purity:Min. 95%Molecular weight:268.43 g/molNeuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt
<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C173H288N56O57Purity:Min. 95%Molecular weight:4,064.48 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H76N18O9S2Purity:Min. 95%Molecular weight:1,209.45 g/molOvokinin trifluoroacetate salt
CAS:Please enquire for more information about Ovokinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C48H67N13O11Purity:Min. 95%Molecular weight:1,002.13 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:<p>PACAP-38 (28-38) is a peptide hormone that is produced in the brain and regulates various physiological processes. It has been shown to have effects on intestinal, pancreatic, and lung cells. PACAP-38 (28-38) is a potent antagonist of vasoactive intestinal polypeptide (VIP), which has been implicated in the regulation of gastrointestinal motility and fluid secretion. The peptide also inhibits cancer cell proliferation by activating cell death pathways.</p>Formula:C61H110N24O14Purity:Min. 95%Molecular weight:1,403.68 g/molToxin GaTx1 trifluoroacetate salt
<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C147H224N46O47S9Purity:Min. 95%Molecular weight:3,676.23 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/molZ-Gly-Pro-Arg-4MbNA acetate salt
CAS:Controlled ProductPlease enquire for more information about Z-Gly-Pro-Arg-4MbNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C32H39N7O6·C2H4O2Purity:Min. 95%Molecular weight:677.75 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:<p>Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/molDABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt
CAS:<p>DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt is a reactive dye that has been shown to bind to the granule neurons of the cerebellum in HL60 cells. It is used as an indicator of protease activity, as it undergoes hydrolysis by serine proteases. DABCYL-Tyr-Val-Ala-Asp-Ala-Pro-Val-EDANS trifluoroacetate salt has also been shown to activate caspase 1 and cause neuronal death in a number of experimental models. This molecule is used for fluorescent labeling and detection of protein synthesis, as well as for visualization of the termini of proteins and other molecules. DABCYL Tyr Val Ala Asp Ala Pro Val EDANS trifluoroacetate salt is also known to be an antiinflammatory agent that may be effective against infectious diseases such as HIV,</p>Formula:C61H76N12O14SPurity:Min. 95%Molecular weight:1,233.39 g/molGamma3-MSH trifluoroacetate salt
CAS:<p>Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C126H188N44O37SPurity:Min. 95%Molecular weight:2,943.18 g/mol4-(Dodecyloxy)benzoic Acid
CAS:<p>4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.</p>Purity:Min. 95%(D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H36N8O5Purity:Min. 95%Molecular weight:540.61 g/molMca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C61H89N17O17Purity:Min. 95%Molecular weight:1,332.46 g/molPz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt
CAS:<p>Pz-Pro-Leu-Gly-Pro-D-Arg-OH trifluoroacetate salt is a synthetic substrate that can be used for the synthesis of cyclic peptides. It has been shown to act as a competitive inhibitor of the serine protease, chymotrypsin, and cytochalasin B. Pz-Pro-Leu-Gly-Pro-D-Arg is a soluble substrate that can be used in tissue culture experiments with caco2 cells. This compound also has high solubility and is stable at pH values between 5 and 12. The optimum pH for this compound is 8.</p>Formula:C38H52N10O8Purity:Min. 95%Molecular weight:776.88 g/mol3-Bromobenzoic acid
CAS:<p>3-Bromobenzoic acid is a molecule that is classified as a Group P2. It has an electronegativity of 1.3 and an acidity of 0.8, which are both in the middle range of values for this group. 3-Bromobenzoic acid is soluble in water and is soluble in ethanol, acetone, and ether. The chemical structure of 3-bromobenzoic acid can be determined by its monoclonal antibody binding sites, electrochemical impedance spectroscopy data, and Langmuir adsorption isotherm data. 3-Bromobenzoic acid reacts with hydrochloric acid to form benzoate and HCl gas. Chronic exposure to 3-bromobenzoic acid has been shown to cause glutamate dehydrogenase inhibition, leading to an accumulation of p-hydroxybenzoic acid in the body. This compound also reacts with thiourea or</p>Formula:C7H5BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:201.02 g/molGalanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C139H210N42O43Purity:Min. 95%Molecular weight:3,157.41 g/molN-Boc-L-pyroglutamic acid ethyl ester
CAS:<p>N-Boc-L-pyroglutamic acid ethyl ester is a chiral building block that can be used for the preparation of amides. It is a good activating agent and is used to synthesize amide bonds from carboxylic acids. N-Boc-L-pyroglutamic acid ethyl ester can be used to synthesize sulfoxides and piperidines, which are ligands. It is also an amido, stereoselective and DPP-4 inhibitor. This chemical simplifies catalysis reactions by replacing the use of toxic solvents.</p>Formula:C12H19NO5Purity:Min. 95%Molecular weight:257.28 g/molAmyloid beta-Protein (1-24) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-24) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C130H183N35O40Purity:Min. 95%Molecular weight:2,876.06 g/mol[2-fluoro-4-(trifluoromethyl)phenyl]boronic Acid
CAS:<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>Formula:C7H5BF4O2Purity:Min. 95%Molecular weight:207.92 g/molLithium acetoacetate
CAS:<p>Lithium acetoacetate is a compound that is used in the treatment of cancer. It is a salt that contains lithium and acetoacetate. Lithium acetoacetate has been shown to be clinically relevant for the treatment of cancer, particularly in patients who have not responded well to other treatments. This drug has also been shown to induce apoptosis in animal cells, which may be due to its ability to produce acid.</p>Formula:C4H6O3•LiPurity:Min. 95%Color and Shape:PowderMolecular weight:109.03 g/mol2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid
CAS:<p>2,2-Dimethyl-4-oxo-3,8,11,14-tetraoxa-5-azahexadecan-16-oic acid (DMTA) is a versatile building block that can be used in the synthesis of a wide variety of compounds. DMTA is an important intermediate for the synthesis of complex molecules and is a useful scaffold for drug development. It has been shown to be an effective reagent for the synthesis of 2,4,6-trinitrobenzenesulfonic acid as well as other useful compounds. DMTA also has high quality and purity with CAS No. 462100-06-7 and is a speciality chemical.</p>Formula:C13H25NO7Purity:Min. 95%Color and Shape:Colorless PowderMolecular weight:307.34 g/mol(D-Ser6,Azagly10)-LHRH acetate salt
CAS:<p>Please enquire for more information about (D-Ser6,Azagly10)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H76N18O14Purity:Min. 95%Molecular weight:1,213.3 g/mol
