Carboxylic Acids

<p>Please enquire for more information about (Lys22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>4-Methoxycarbonylphenylboronic acid is an organic compound that can be synthesized from biphenyl. It is a diazonium salt with a bidentate ligand and a carbonyl group, which allows it to form an intermolecular hydrogen bond. The phenyl group of 4-methoxycarbonylphenylboronic acid can be oxidized to the corresponding carboxylic acid or reduced to the corresponding alcohol.<br>4-Methoxycarbonylphenylboronic acid is also soluble in halides, iodinations, and mercaptoacetic acid. This compound has been used as an acceptor in the oxidation of aluminium with diborane as a catalyst. 4-Methoxycarbonylphenylboronic acid has also been used to synthesize other compounds such as metronidazole (a drug) and erythromycin (an antibiotic).</p>

<p>Please enquire for more information about 5(6)-TAMRA-HIV-1 tat Protein (47-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-2 (1-6) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Amino-3-vinyl-3-cephem-4-carboxylic acid (AVC) is a synthetic, inorganic acid that is used clinically. It is produced by the hydrolysis of chlorocarboxylic acids and has been shown to be effective as an antihypertensive agent. AVC has also been used as a catalyst for acylation reactions with chlorides and trifluoroacetic acid. This process yields a reaction yield that can be up to 95% with the use of catalysts such as aluminum chloride or zinc chloride. AVC has been shown to be an environmentally safe alternative to hydrogen chloride, which has been linked to environmental pollution.</p>

<p>Trifluoroacetate salt</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Matrix Protein M1 (58-66) (Influenza A virus) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>

<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>

<p>Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate is a metabotropic glutamate receptor antagonist. It blocks the glutamate receptor and prevents the transmission of nerve impulses in the central nervous system. This drug is used to treat neurological disorders such as anxiety, depression, and schizophrenia. Methyl 1-oxo-2,3-dihydro-1H-indene-5-carboxylate has been shown to have a number of side effects including drowsiness, nausea, dizziness and headache.</p>

<p>3,5-Dibromobenzoic acid methyl ester is an organic compound that has isomers. It is a synthetic substance with the chemical formula CHBrO. This substance can be obtained by reacting benzoic acid with bromine in the presence of aluminium chloride. The nature of this substance is not known due to its multifold structure. 3,5-Dibromobenzoic acid methyl ester has been shown to absorb light and transfer it to another molecule. This molecule can then emit light of a different wavelength or energy level. The dipole moment of the substance interacts with other molecules in close proximity, leading to the transfer of electrons and photons from one molecule to another.</p>

<p>Anxiety Peptide acetate salt H-Gln-Ala-Thr-Val-Gly-Asp-Val-Asn-Thr-Asp-Arg-Pro-Gly-Leu-Leu-Asp-Leu Lys is a peptide that has been shown to have neurotrophic activity and the ability to modulate locomotor activity in mice. This compound has also been shown to inhibit dpp iv, a protein that is involved in the regulation of neuronal death. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt also inhibits the polymerase chain reaction, which is an enzyme that synthesizes DNA from RNA templates. Anxiety Peptide acetate salt H Gln Ala Thr Val Gly Asp Val Asn Thr Arg Pro Gly Leu Leu Asp Leu Lys OH acetate salt has been shown</p>

<p>3-Methylbutanoic acid is an antimicrobial agent that belongs to the group of isovaleric acids. It is a product of β-oxidation and has been shown to inhibit the growth of bacteria by reacting with their surface. 3-Methylbutanoic acid inhibits bacterial growth by binding to the pyrazole ring in DNA and altering its conformation, preventing DNA replication. This reaction occurs at a rate comparable to that of other fluoroquinolones, such as ciprofloxacin, levofloxacin, and norfloxacin. 3-Methylbutanoic acid has been shown to have antibacterial activity against both Gram-positive and Gram-negative bacteria, particularly those that are resistant to erythromycin or lincomycin.</p>

<p>Vasotocin is a peptide that belongs to the family of arginine vasotocin and oxytocin receptor antagonists. It is synthesized in the rat kidney, where it is stored in vesicles. Vasotocin has been shown to bind to the oxytocin receptor, which regulates many physiological processes such as muscle contraction, ejaculation, and milk letdown. Vasotocin also modulates the activity of antigen-presenting cells and can be used for pharmaceutical formulations. This drug has been shown to be effective against congestive heart failure and may be used as a diluent for other drugs.br&gt;br&gt;<br>Vasotocin trifluoroacetate salt (VT) is an oxime derivative that can be isolated from vasotocin. The synthesis of VT involves converting vasotocin into its trifluoroacetate salt by adding trifluoroacetic acid, followed by reacting with hydroxylam</p>

<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>Please enquire for more information about (D-Lys16)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>Sodium fluoroacetate is a salt that is synthesized by the reaction of methyl ethyl and sodium trifluoroacetate. It has been used as an insecticide, but also has been used to treat metabolic disorders such as bowel disease and eye disorders. Sodium fluoroacetate also has been used in natural products for the treatment of autoimmune diseases. The toxicological studies of sodium fluoroacetate have shown that it can cause eye disorders and x-ray crystal structures have revealed its mechanism of action.</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Val-Leu-Lys-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Nitro nicotinic acid is a drug that has been synthesized in the laboratory. It is a white crystalline solid with a molecular weight of 201.18, and it has the chemical formula of C6H5NO2. 5-Nitro nicotinic acid is an antitubercular drug that inhibits Mycobacterium tuberculosis and Mycobacterium avium complex without inhibiting other human cells. It also inhibits the growth of bacteria that are resistant to aminoglycosides (e.g., Pbtz169). This drug binds to the enzyme NADH dehydrogenase, which leads to inhibition of bacterial respiration and ATP synthesis. 5-Nitro nicotinic acid also has antimycobacterial activity against mycobacteria by forming nitric oxide radicals (NO) through hydrogen peroxide oxidation, which react with cellular components such as DNA and proteins.</p>

<p>Please enquire for more information about Abz-Gly-Ala-Lys(Ac)-Ala-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Lys-Pro-Leu-Ala-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>

<p>Lercanidipine is a calcium antagonist that binds to the calcium channels in the membranes of cells, preventing the entry of calcium ions. Lercanidipine is water soluble and can be synthesized using techniques such as elemental analysis and pharmacological techniques. It is also an ionizable drug, which means that its affinity for chloride varies with pH. Lercanidipine has been shown to have strong affinity for erythrocyte membranes and thus has a high selectivity for vascular smooth muscle cells. This drug also has a low toxicity profile and does not affect tissues other than vascular smooth muscle cells.</p>

<p>Please enquire for more information about Cell-permeable Caspase-1 Inhibitor I trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Fluoro-4-(trifluoromethyl)phenylboronic acid is a boron compound that can be used to synthesize a variety of target products. 2-Fluoro-4-(trifluoromethyl)phenylboronic acid occurs in the form of an oil and is an impurity in the target product, phenylboronic acid. This impurity can be removed by reacting with lithium benzotrifluoride. Lithiated 2-fluoro-4-(trifluoromethyl)phenylboronic acid is then reacted with phenylboronic acid to give lithiated phenylboronic ester in high yield. The lithiation reaction can be carried out under alkaline conditions or under a condition where the reactants are dissolved in water.</p>

<p>Please enquire for more information about (+)-3-Bromo-10-camphorsulfonic acid monohydate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-Difluorobenzoic acid is a pharmaceutical preparation that has been used in the treatment of inflammatory diseases and cancer. It is an enantiomer of 5-Fluorobenzoic acid. 3,5-Difluorobenzoic acid can be synthesized from 2,4-dichlorophenoxyacetic acid by cycloaddition process with fluorine. Magnetic resonance spectroscopy has shown that 3,5-Difluorobenzoic acid binds to oxytocin receptor. The binding of 3,5-Difluorobenzoic acid to oxytocin receptor leads to the activation of its G protein coupled receptor activity. This causes an increase in intracellular cAMP levels and subsequently leads to the inhibition of bacterial enzyme ns3 protease and cardiac hypertrophy induced by chronic angiotensin II infusion.</p>

<p>Hel 13-5 trifluoroacetate salt H-Lys-Leu-Leu-Lys-Leu-Leu-Leu-Lys-Leu-Trp-Leu-Lys-Leu-Leu-Lys-Leu-Leu<br>Hel 13 is a ternary anionic surfactant consisting of a helix and three head groups. The head groups are Lys, Leu, and Leu. Each of these three head groups have a hydrophilic polar group and two lipophilic chains. It is typically used as a surfactant in the pulmonary system to help maintain lung function. When Hel 13 is used in the pulmonary system, it helps to keep the alveoli open so that air can be exchanged with blood. Hel 13 also has been shown to reduce surface tension at high pressures and temperatures, which could potentially be used for industrial purposes such as oil drilling or nuclear power plants.</p>

<p>Neuropeptide Y (18-36) trifluoroacetate salt H-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg -Gln is a peptide belonging to the family of neuropeptides. It has been shown to have potent vasoconstricting activity in rat and guinea pig hearts, as well as contractile activity in rat aortic rings. Neuropeptide Y (18 - 36) trifluoroacetate salt H -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifl uoroacetate salt also inhibits the cyclase activity of adenylate cyclase, which is responsible for generating the second messenger cAMP. This compound may be used to treat congest</p>

<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Acetamidophenyl boronic acid is a cross-coupling reagent that has been used in the synthesis of a variety of organic molecules. The reaction is stereoselective and proceeds with high yield. 4-Acetamidophenyl boronic acid has also been used to synthesize amides and azobenzenes, which can be substituted with chloride or uv irradiation to give chloroazobenzene or benzotriazole respectively. 4-Acetamidophenyl boronic acid has shown potent inhibition against the enzyme cyclooxygenase 2 (COX2) and acidic hydrolysis.</p>

<p>Please enquire for more information about (D-Lys6)-LHRH (free acid) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methylsalicylic acid is a naturally occurring carboxylate that has been shown to be an inhibitor of the hydrogenation of polyunsaturated fatty acids. 3-Methylsalicylic acid inhibits the binding of benzyl groups to intramolecular hydrogen and hydroxyl groups, which are required for the formation of a covalent bond. The antiproliferative effect of 3-methylsalicylic acid on cancer cells is due to its ability to inhibit protein synthesis by blocking the enzyme carboxylase. 3-Methylsalicylic acid also has anti-inflammatory properties and can be used as an antiseptic and analgesic.</p>