Carboxylic Acids

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L(+)-2,3-Diaminopropionic acid HCl is a chiral modifier that is used in the separation of organic compounds. It has been shown to selectively interact with borate, sulfate, and hydroxyapatite. This interaction changes the physical properties of these substances by modifying their surface charge or adsorption capacity. L(+)-2,3-Diaminopropionic acid HCl has also been shown to be useful in diastereoselective reactions. The technique of elution can be used to isolate specific compounds from mixtures using this compound as a modifier. Hydrogen bonding groups and moieties on the functional group are important factors in the specificity of this interaction.END&gt;&gt;</p>

<p>Please enquire for more information about Cytochrome C (88-104) (domestic pigeon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Thymalfasin is a peptide that belongs to the thymosin family. It is a biocompatible polymer with a number of biomedical applications, including as a component in wound dressings and anti-adhesive agents. Thymalfasin has been shown to be effective at inhibiting the replication of influenza A virus, which may be due to its ability to bind to toll-like receptor 4 (TLR4). This drug also has antitumor properties and has been shown to stimulate the production of IL-2 receptor in human monocytes. Thymalfasin also inhibits the growth of cancer cells, such as HL60 cells, by blocking DNA synthesis. The molecular weight of this compound is approximately 20-30 kDa.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>Bosentan is a potent inhibitor of the uptake of organic anions. It is used in the treatment of pulmonary arterial hypertension and has been shown to be effective against pravastatin-resistant HIV protease inhibitors, such as saquinavir, quinidine, and rosuvastatin. Bosentan inhibits uptake by binding to the transporter protein at a site that does not overlap with the binding site for organic anion substrates. This leads to a change in kinetic parameters for substrates, such as pravastatin and saquinavir. The binding site on bosentan may also be elucidated through monolayer experiments with efflux transporters.</p>

<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>

<p>2-(2-Naphthyloxy)propanoic acid is a naphthalene derivative that is found in the plant species Carthamus tinctorius. It has been shown to have potent antagonist activity against the NMDA receptor, as well as antinociceptive and analgesic properties in vivo. 2-(2-Naphthyloxy)propanoic acid also shows potent anti-inflammatory and cardioprotective effects in vitro and in vivo. 2-(2-Naphthyloxy)propanoic acid can be used for the treatment of bone cancer, congestive heart failure, diabetic neuropathy, or other disorders of the peripheral nervous system.</p>

<p>N,N-bis(Carboxymethyl)-L-glutamic acid is a synthetic compound that functions as a disinfectant. It has been shown to be effective against bacteria and fungi in vitro, with an efficacy of over 90%. N,N-bis(Carboxymethyl)-L-glutamic acid is used as a treatment for tumors due to its ability to penetrate the tumor cells and inhibit fatty acid uptake. This compound also prevents the formation of new blood vessels by inhibiting the synthesis of DNA and RNA. N,N-bis(Carboxymethyl)-L-glutamic acid can be used in coatings for metals or metal surfaces that are exposed to water or air because it is biodegradable and noncorrosive.</p>

<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>

<p>2-Bromopropionic acid benzyl ester is a synthetic compound with a molecular weight of 220.24 g/mol. It is soluble in organic solvents and has a hydroxyl group at its alpha position. 2-Bromopropionic acid benzyl ester is used in the synthesis of beta-cyclodextrin, which is an important biomaterial for drug delivery as well as other applications. 2-Bromopropionic acid benzyl ester also has antioxidant properties and can be used to treat leukemia cells by inhibiting the production of reactive oxygen species (ROS).</p>

<p>3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is a versatile building block for the synthesis of complex compounds. It is used as a reagent to make other chemicals and has been used in the synthesis of research chemicals. 3-(2,3,5,6-Tetramethylbenzoyl)-acrylic acid is also useful as an intermediate or scaffold compound in organic chemistry. This product has high purity and quality.</p>

<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>

<p>Please enquire for more information about Isopropyl 2-amino-4-hydroxy-5,8-dihydropyrido[3,4-d]pyrimidine-7(6H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5,7-Docosadiynoic acid is a fluorescent molecule that has been found to have low molecular weight, which makes it ideal for use in a variety of strategies. This compound can be used as a fluorescent probe for the detection of membrane interactions and also has many potential applications in polymerized optical devices. 5,7-Docosadiynoic acid is able to fluoresce when irradiated with light at wavelengths above 500 nm and has been shown to be excited by UV light. The chemical properties of 5,7-docosadiynoic acid make it an excellent candidate for use in sensors and optical devices.</p>

<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>

<p>1-Adamantylphosphonic acid (1APA) is a trifluoroacetic acid derivative that is used as an organic solvent. It is also a catalyst in organic chemistry. 1APA can be used to catalyze the carbonylation of olefins with phosphines, which are ligands that bind to metal compounds and facilitate chemical reactions. Ferrocene, adamantyl, and metallocene are all examples of ligands. 1APA is also used as a reagent in the synthesis of phosphine ligands, which are used in catalytic reactions.</p>

<p>(S)-(-)-6,7-Dimethoxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride is a synthetic chiral compound that is used to study the role of glyoxylate in biochemical reactions. This drug is an enolate and alkylating agent that can react with nucleophiles such as amines and thiols. It has been shown to be effective against perchlorates by hydrolyzing them into chlorine and oxygen gas. This drug has also been shown to inhibit the growth of Rhodobacter sphaeroides by inhibiting glyoxylate metabolism.</p>

<p>N-(2-Pyridyl)oxamic acid is a non-steroidal anti-inflammatory drug that belongs to the group of piroxicam. It was found to be a competitive inhibitor of the reaction between singlet oxygen and certain organic compounds. The reaction rate of N-(2-pyridyl)oxamic acid is dependent on the concentration of solvent, which affects the solvation of the reactants and products. The tautomerization equilibrium constant for N-(2-pyridyl)oxamic acid has been determined as 1.3 × 10 at 25°C in acetonitrile, with an apparent molecular weight of 251.6 g/mol. The singlet oxygen constant (Ks) for this compound is 2.8 × 10 at 25°C in acetonitrile, with a maximum absorbance wavelength at 295 nm and a half life time of 0.27 seconds at 298 K in pure water.</p>

<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>

<p>α-MSH (11-13) (free acid) acetate salt is a synthetic, nonsteroidal compound that binds to and activates α-melanocyte-stimulating hormone receptors. It has been used as an antiinflammatory agent in the treatment of inflammatory bowel disease and bowel disease. α-MSH (11-13) (free acid) acetate salt is also being studied as a contraceptive and an elastase inhibitor. This drug has shown some promise in the treatment of autoimmune diseases, such as rheumatoid arthritis, Crohn's disease, ulcerative colitis, multiple sclerosis, and type 1 diabetes mellitus. It is thought that α-MSH (11-13) (free acid) acetate salt may inhibit the production of inflammatory cells by inhibiting leukocyte elastase activity.</p>

<p>Please enquire for more information about 5-(Morpholin-4-ylmethyl)isoxazole-3-carboxylic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Lysergic acid hydrazide is a synthetic drug with an active form of lysergic acid. It is used in the synthesis of ergocryptine and other drugs. The compound can be synthesized using methyl alcohol, trifluoromethyl group, hydroxy group, skeleton, and C1-4 alkyl as reactants. Lysergic acid hydrazide can also be synthesized from an inorganic acid such as nitrous or oxoalkyl. This compound has been used as a pharmaceutical preparation for the treatment of psychotic disorders. Lysergic acid hydrazide has shown to have reactive amide groups that may react with organic amines to form neurotoxic compounds.</p>

<p>Please enquire for more information about Methyl 4- bromo- 5- methyl- 1H- imidazole- 2- carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl (2R,3S)-(-)-6-oxo-2,3-diphenyl-4-morpholinecarboxylate is a chiral compound that contains two stereogenic centers. It is a racemate of enantiomers. The enantiomeric purity can be determined by the preparative method. This compound is soluble in water and is stable in neutral or acidic conditions. It has been shown to act as an α-amino acid and to inhibit glycine uptake by neurons.</p>

<p>Please enquire for more information about 4-Acetylamino-5-bromo-2-methoxy-benzoic acid methylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amylin (free acid) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycodehydrocholic acid is a bile acid that is synthesized from cholesterol by the liver and intestine. It is used for the diagnosis of cancer and other medical conditions, such as obesity. Glycodehydrocholic acid inhibits the growth of adipose tissue cells, which may be due to its ability to increase the expression of genes related to lipid metabolism. This drug has also been shown to have an inhibitory effect on mitochondria and tumor cells in human serum. Glycodehydrocholic acid can be measured using chromatographic methods with a sample preparation before analysis. This drug can also be detected in urine samples by gas-liquid chromatography or mass spectrometry. The metabolic profiles of women differ from men, so it is important to take this into account when performing analytical chemistry procedures on this compound.</p>

<p>2,4-Dihydroxybenzenesulfonic acid is a chemical compound that is used as a polymerization catalyst. It is most commonly used in the production of polyoxyethylene and copolymers. The catalytic activity of 2,4-dihydroxybenzenesulfonic acid is due to its acid group and hydroxy groups. This chemical can also be prepared by the reaction of resorcinol and hydrogen peroxide. The fluidity of this compound can be increased by adding an appropriate fluidizing agent such as peroxide or ammonium persulfate.</p>

<p>2-[(2,3-Dimethylphenyl)amino]nicotinic acid is an arylpropionic acid that has been designed for the treatment of cancer. It is a neutral compound that can be crystallized or sterilized and then injected or implanted into tissues. The compound can be used as a diagnostic tool to target specific tissues in the body by using iontophoresis or organic solvents. 2-[(2,3-Dimethylphenyl)amino]nicotinic acid interacts with chlorine ions to form a chloride derivative, which is then transported through the tissue. This process can be reversed by adding an acid solution to the tissue, which will cause the chloride ions to break down into hydrogen and chloride ions.</p>

<p>Please enquire for more information about 5-[4-(1,2,4,5-Tetrazin-3-yl)benzylamino]-5-oxopentanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fusidic acid is a hydrophilic antibiotic that is structurally related to penicillin. It has a cavity that interacts with γ-cyclodextrin, which can be used for its monitoring and stoichiometry. Fusidic acid has hydroxyl groups that are located on the 7th and 8th positions of the fusidate ring. This antibiotic has been shown to have stability constants in a range of 10-10 M. Fusidic acid also has two electrophoretically distinct forms, depending on the pH of the solution. The form at pH 10 is called fusidane, while the form at pH 5 is called fusidate.</p>

<p>Sodium phenylacetate is a chemical compound that is used as an antifungal agent in vitro. It has also been shown to have anti-proliferative and cytotoxic effects on neuroblastoma cells. The physiological function of sodium phenylacetate is not well understood, but it may act as a neurotransmitter by inhibiting the release of acetylcholine or by regulating cell signaling pathways. Sodium phenylacetate may also inhibit angiogenesis, which would limit the growth of cancerous tumors.</p>

<p>C-type Natriuretic peptide is a peptide hormone that causes vasodilation, diuresis, and natriuresis. It is secreted by the heart and kidneys in response to volume overload. C-type Natriuretic peptide has been shown to cause fibrosis of the kidney as well as other tissues in mice. The binding of C-type Natriuretic peptide to its receptor activates cyclase, which converts ATP into cAMP. This leads to increased levels of cGMP, which causes smooth muscle relaxation and vasodilation.</p>

<p>Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt is a prohormone that is biosynthesized from the amino acid decanoic acid. It has been shown to inhibit fatty acid synthesis and mineralization in tissue samples, as well as drug target enzymes such as human pathogens. Decanoyl-arginine-arginine-leucine-chloromethylketone trifluoroacetate salt has also been shown to have insulin resistance properties and may be used for the treatment of metabolic disorders.</p>