Primary Antibodies

<p>ARID5A antibody was raised in rabbit using the N terminal of ARID5A as the immunogen</p>

<p>KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA</p>

<p>RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV</p>

<p>SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL</p>

<p>SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA</p>

<p>CASP5 antibody was raised in rabbit using the middle region of CASP5 as the immunogen</p>

<p>Snap29 antibody was raised in rabbit using the middle region of Snap29 as the immunogen</p>

<p>ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK</p>

<p>Chymotrypsinogen B1 antibody was raised using the N terminal of CTRB1 corresponding to a region with amino acids MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVS</p>

<p>UGT1A6 antibody was raised using the C terminal of UGT1A6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK</p>

<p>ZNF597 antibody was raised in rabbit using the middle region of ZNF597 as the immunogen</p>

<p>ZNF131 antibody was raised in rabbit using the middle region of ZNF131 as the immunogen</p>

<p>The PFKP antibody is a specific antibody used in Life Sciences research. It is designed to target and detect the presence of the PFKP protein, a polymorphic glycoprotein involved in syncytia formation. This antibody can be used in various applications such as immunoblotting, immunohistochemistry, and flow cytometry. The PFKP antibody has been validated for use with human serum samples and has shown high specificity and sensitivity. It can be used in conjunction with lectins or other glycan-binding proteins for further analysis. This monoclonal antibody is available as magnetic particles conjugated with the PFKP-specific antibody, allowing for easy separation and purification of target molecules. With its high affinity and specificity, this PFKP antibody is an essential tool for researchers studying the function and regulation of this important protein in various biological systems.</p>

<p>COLEC12 antibody was raised using the N terminal of COLEC12 corresponding to a region with amino acids AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQ</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.</p>

<p>KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES</p>

<p>NR2F1 antibody was raised in rabbit using the N terminal of NR2F1 as the immunogen</p>

<p>GJB1 antibody was raised using the middle region of GJB1 corresponding to a region with amino acids RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR</p>

<p>COL8A2 antibody was raised in rabbit using the middle region of COL8A2 as the immunogen</p>

<p>SCCPDH antibody was raised using a synthetic peptide corresponding to a region with amino acids FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK</p>

<p>KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN</p>

<p>CD22 antibody was raised in rabbit using the C terminal of CD22 as the immunogen</p>

<p>STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY</p>

<p>ZNF318 antibody was raised in rabbit using the N terminal of ZNF318 as the immunogen</p>

<p>OSGIN2 antibody was raised in rabbit using the C terminal of OSGIN2 as the immunogen</p>

<p>SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK</p>

<p>Gm5581 antibody was raised in rabbit using the N terminal of Gm5581 as the immunogen</p>

<p>Prostein antibody was raised in rabbit using N terminal sequence ITYVPPLLLEVGVEE and C terminal sequence FATQVVFDKSDLAKYSA of the human prostein protein as the immunogen.</p>

<p>TXNDC13 antibody was raised using the C terminal of TXNDC13 corresponding to a region with amino acids GVDEERSEANDQGPPGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSL</p>

<p>CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS</p>

<p>Ghitm antibody was raised in rabbit using the middle region of Ghitm as the immunogen</p>

<p>FAM78A antibody was raised in rabbit using the C terminal of FAM78A as the immunogen</p>

<p>SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL</p>

<p>HNF1A antibody was raised in rabbit using the N terminal of HNF1A as the immunogen</p>

<p>BRCAA1 antibody was raised in rabbit using residues 1046-1055 [SSKKQKRSHK] of the 136 kDa human, mouse and rat BRCAA1 protein as the immunogen.</p>

<p>SCAPER antibody was raised in rabbit using the N terminal of SCAPER as the immunogen</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC</p>

<p>FLJ44894 antibody was raised in rabbit using the middle region of FLJ44894 as the immunogen</p>

<p>USP8 antibody was raised in rabbit using the C terminal of USP8 as the immunogen</p>

<p>Lyn antibody was raised in rabbit using the N terminal of Lyn as the immunogen</p>

<p>C8orf77 antibody was raised in rabbit using the C terminal of C8ORF77 as the immunogen</p>

<p>FBXL12 antibody was raised in rabbit using the C terminal of FBXL12 as the immunogen</p>

<p>YIF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA</p>

<p>SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE</p>

<p>Purified Polyclonal ABCD1 antibody</p>

<p>TIE1 antibody was raised in rabbit using a 21 amino acid peptide of human TIE1 conjugated to KLH.</p>

<p>SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS</p>

<p>GLUT10 antibody was raised in rabbit using residues 367-385 (ILSTAKKTKPHPRSGDPSA) of the human, mouse and rat GLUT10 protein as the immunogen.</p>

<p>KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE</p>

<p>ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS</p>

<p>RAD17 antibody was raised in rabbit using residues 10-23 [STKRSLKKKKIRKI] of the S. pombe RAD17 75 kDA protein as the immunogen.</p>

<p>XPNPEP3 antibody was raised in rabbit using the N terminal of XPNPEP3 as the immunogen</p>

<p>KCNS1 antibody was raised in rabbit using the N terminal of KCNS1 as the immunogen</p>

<p>ALDH3A1 antibody was raised in rabbit using the C terminal of ALDH3A1 as the immunogen</p>

<p>ZNF226 antibody was raised in rabbit using the middle region of ZNF226 as the immunogen</p>

<p>GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP</p>

<p>Septin 2 antibody was raised using the middle region of 40423 corresponding to a region with amino acids LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK</p>

<p>FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH</p>

<p>ZNF322A antibody was raised in rabbit using the C terminal of ZNF322A as the immunogen</p>

<p>Zfp90 antibody was raised in rabbit using the N terminal of Zfp90 as the immunogen</p>

<p>Tetraspanin 10 antibody was raised using the N terminal of TSPAN10 corresponding to a region with amino acids SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>PARP10 antibody was raised in rabbit using the N terminal of PARP10 as the immunogen</p>

<p>BAD antibody was raised in rabbit using the C terminal of BAD as the immunogen</p>

<p>PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV</p>

<p>ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR</p>

<p>DRGX antibody was raised in rabbit using the middle region of DRGX as the immunogen</p>

<p>USP15 antibody was raised in rabbit using the C terminal of USP15 as the immunogen</p>

<p>XPO5 antibody was raised in rabbit using the middle region of XPO5 as the immunogen</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH</p>

<p>OR1D2 antibody was raised in rabbit using the C terminal of OR1D2 as the immunogen</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.</p>

<p>MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG</p>

<p>Affinity purified Goat polyclonal CYP46A1 antibody</p>

<p>SLC25A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF</p>

<p>IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC</p>

<p>Purified Polyclonal SP3/4 antibody</p>

<p>ENOPH1 antibody was raised in rabbit using the middle region of ENOPH1 as the immunogen</p>

<p>CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF</p>

<p>SFXN4 antibody was raised in rabbit using the N terminal of SFXN4 as the immunogen</p>

<p>GJA8 antibody was raised using the middle region of GJA8 corresponding to a region with amino acids EEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPEL</p>

<p>MCP2 antibody was raised in rabbit using highly pure recombinant murine MCP-2 (Mouse MCP-2) as the immunogen.</p>

<p>ZNF284 antibody was raised in rabbit using the C terminal of ZNF284 as the immunogen</p>

<p>The ZAK antibody is a monoclonal antibody that specifically targets and binds to the ZAK protein. This protein plays a crucial role in various cellular processes and signaling pathways, making it an important target for research and therapeutic applications.</p>

<p>EXOC1 antibody was raised in rabbit using the N terminal of EXOC1 as the immunogen</p>

<p>CDK8 antibody is a monoclonal antibody that specifically targets and neutralizes CDK8, an enzyme involved in cell cycle regulation. This antibody has been extensively tested in various assays and has shown inhibitory effects on CDK8 activity. It has been demonstrated to inhibit the growth of cardiomyocytes and enhance the expression of annexin A2, a protein involved in cell adhesion and apoptosis. Additionally, CDK8 antibody has been shown to modulate the secretion of glucagon, a hormone involved in glucose metabolism. This antibody can be used in research studies and as a tool for investigating the role of CDK8 in various biological processes.</p>

<p>NLGN4X antibody was raised using the middle region of NLGN4X corresponding to a region with amino acids ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE</p>

<p>The Annexin A2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and inhibit annexin A2, a protein involved in various cellular processes. This antibody can be used in assays to study the function of annexin A2 and its role in different biological pathways. The Annexin A2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their experiments. With its high specificity and sensitivity, this antibody is a valuable tool for studying annexin A2 and its interactions with other molecules. Whether you are investigating multidrug resistance, chemokine signaling, or glucagon regulation, the Annexin A2 antibody can help advance your research in the field of Life Sciences.</p>

<p>ADD3 antibody was raised in rabbit using the C terminal of ADD3 as the immunogen</p>

<p>ARR3 antibody was raised in rabbit using the C terminal of ARR3 as the immunogen</p>

<p>ABHD13 antibody was raised using the C terminal of ABHD13 corresponding to a region with amino acids LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT</p>

<p>Tmem184b antibody was raised in rabbit using the middle region of Tmem184b as the immunogen</p>

<p>TOMM34 antibody was raised in rabbit using the N terminal of TOMM34 as the immunogen</p>

<p>Laminin Beta 1 antibody was raised using the middle region of LAMB1 corresponding to a region with amino acids VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENL</p>

<p>ZNF648 antibody was raised in rabbit using the N terminal of ZNF648 as the immunogen</p>

<p>Purified Polyclonal AMYB antibody</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD</p>

<p>PHF12 antibody was raised in rabbit using the C terminal of PHF12 as the immunogen</p>

<p>PSCA antibody was raised in rabbit using the C terminal of PSCA as the immunogen</p>

<p>TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK</p>

<p>HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen</p>

<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>

<p>GOLGA5 antibody was raised using the N terminal of GOLGA5 corresponding to a region with amino acids FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS</p>

<p>Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids DPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQV</p>

<p>ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL</p>

<p>PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.</p>

<p>GFAP antibody was raised in rabbit using the N terminal of Gfap as the immunogen</p>

<p>Cyb5r2 antibody was raised in rabbit using the C terminal of Cyb5r2 as the immunogen</p>

<p>IL15 antibody was raised in rabbit using highly pure recombinant murine IL-15 as the immunogen.</p>

<p>The Beta Amyloid antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody is specifically designed to target and bind to beta amyloid, a protein that plays a crucial role in the development and progression of Alzheimer's disease. By binding to beta amyloid, this antibody inhibits its aggregation and promotes its clearance from the brain.</p>

<p>KSHV ORF8 antibody was raised in rabbit using a synthetic peptide corresponding to the amino acid sequence of KSHV ORF8  as the immunogen.</p>

<p>TIMP3 antibody was raised in rabbit using the middle region of TIMP3 as the immunogen</p>

<p>CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW</p>

Monoclonal antibody against EGFR

<p>Anti-Human PCSK9 Monoclonal Antibody; 98%</p>

<p>Blinatumomab is a bispecific T-cell engager (BiTE), an immunotherapy specifically designed to target and redirect the body's immune system to attack cancer cells. This is possible as Blinatumomab has two single-chain antibody variable fragments. One of these targets CD3+ on T-cells while the other recognizes CD19 on malignant B-cells. As such the body's T-cells become activated and exert cytotoxic activity on the target cell.<br>Blinatumomab has been approved for the treatment of a type of acute lymphoblastic leukemia (ALL) called Philadelphia chromosome-negative B-cell precursor ALL. This medication has demonstrated efficacy in patients with relapsed or refractory ALL, and it has also been used in the minimal residual disease (MRD) setting to help eliminate any remaining cancer cells after initial treatment. <br>One advantage of Blinatumomab is that, CD3 and CD19 are present in both pediatric and adult patients. As such it can be a potential therapeutic for both patient sets.</p>

Contains 0.1% Proclin300 as preservative

<p>Pig RBC antibody was raised in rabbit using porcine erythrocytes as the immunogen.</p>

Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment</p>

<p>Sheep polyclonal Creatinine Acid antibody</p>

<p>The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.</p>

<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

NCGC00229600: Allosteric inverse TSHR agonist; blocks TSH and antibody TSHR activation; for Graves' disease research.

<p>Benzoylecgonine antibody was raised in mouse using benzoyl ecgonine-BSA as the immunogen.</p>

Mucin antibody was raised in mouse using Mucin isolated from ovarian mucinous cysts and colonic mucosa as the immunogen.

<p>CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.</p>

<p>The Methotrexate antibody is a monoclonal antibody that specifically targets and binds to Methotrexate, a commonly used cytotoxic drug in the field of Life Sciences. This antibody has been extensively tested and validated for its high affinity and specificity towards Methotrexate. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The Methotrexate antibody works by binding to Methotrexate molecules and preventing their interaction with their target enzymes involved in DNA synthesis. This inhibits the growth of cancer cells and autoimmune responses mediated by activated T-cells. Additionally, this antibody can also be utilized as a tool for studying the intracellular localization and trafficking of Methotrexate within cells. The unique features of this Methotrexate antibody include its ability to recognize both free Methotrexate molecules as well as Methotrexate conjugated to proteins or other biomolecules. It exhibits minimal cross-reactivity with</p>

<p>Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>

<p>Progesterone-3 antibody was raised in sheep using 17-OH-Progesterone-3-BSA as the immunogen.</p>

<p>The CYFRA21-1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets fibronectin, a protein involved in cell adhesion and migration. It has cytotoxic properties, making it useful for studying cellular processes and identifying potential therapeutic targets. Additionally, the CYFRA21-1 antibody can be used to detect inhibitory factors or antiphospholipid antibodies in biological samples. It is also effective in detecting insulin antibodies, autoantibodies, and antibodies involved in glycosylation processes. With its high specificity and sensitivity, this monoclonal antibody is an invaluable tool for researchers looking to uncover new insights into various biological pathways and disease mechanisms.</p>

<p>2A peptide-linked polycistronic vectors can be used to express multiple proteins from a single open reading frame (ORF). The small 2A peptide sequences, when cloned between genes, allows for efficient, stoichiometric production of discrete protein products within a single vector through a novel "cleavage" event within the 2A peptide sequence. 2A was discovered in the foot-and-mouth disease virus (FMDV, a picornavirus). The 2A peptide acts through ribosomal skipping to allow for the encoding of polyproteins which can dissociate into individual proteins upon translation. Anti-T2A antibody recognises 2A tagged recombinant proteins and is an excellent tool for researchers using 2A peptide based expression systems.<br>0.2mg/ml TEA (Rb L02T), 0.5mg/ml Glycine (Rb L02G). Used for ELISA (1:1000). Reacts with T2A tag.</p>

<p>Extracellular signal-regulated kinase 1/2 (ERK1/2) is a mitogen-activated protein kinase (MAPK) family protein and part of the Ras-Raf-MEK-ERK signalling pathway which plays a key role in controlling cell proliferation, differentiation and cell survival. ERK1/2 acts downstream of activated growth factor receptors, RAF protein kinases and mitogen-activated protein kinase kinases 1 and 2 (MEK1/2). MEK1 and MEK2 activate ERK1/2 by phosphorylation and once activated ERK1/2 enters the nucleus and phosphorylates transcription factors to induce changes in gene expression. In addition to this active ERK1/2 also translocates to other organelles including the endoplasmic reticulum, endosomes, golgi and mitochondria where it influences cell physiology. Overall ERK1/2 phosphorylates more than 200 different substrates including other protein kinases, transcription factors, RNA-binding proteins, regulators of mRNA translation and regulators of cell death. ERK1/2 pathway is strongly implicated in cancer where its hyperactivation underpins the growth and maintenance of many tumour types. Data: Western blot analysis of whole cell extract of Mouse embryonic Fibroblasts (MEFs).</p>

<p>Primate-specific Mas-related G protein-coupled receptor-X1 (MRGPR-X1) is highly enriched in dorsal root ganglia (DRG) neurones as well as in connective tissue mast cells (CTMC) and the leukaemia-derived human mast cell line (LAD)-2. MRGPR-X1 activation induces acute pain and therefore represents a promising target for future pain therapy. MRGPR-X1 is activated by bovine adrenal medulla peptide-8-22 (BAM 8-22) which is cleaved from pro-enkephalin by pro-hormone convertases. Unlike most if not all Gq-coupled receptors MRGPR-X1 does not undergo agonist-promoted endocytosis. Data: Western blot analysis of rat brain preparation. Lane 1: Rat brain preparation (20µg). Secondary: Goat anti-rabbit IgG conjugated to HRP 1:5000.</p>

<p>Anti-Trop2</p>

<p>The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper</p>

<p>The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]</p>

<p>This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008],</p>

<p>Activation of caspase-3 requires proteolytic processing of its inactive zymogen into activated p17 and p12 fragments. Cleavage of caspase-3 requires aspartic acid at the P1 position.</p>

<p>This gene encodes the 125-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Mar 2012],</p>

<p>This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may play a role in multiple processes including hypotension, smooth muscle relaxation and cardioprotection by mediating the effects of angiotensin-(1-7). [provided by RefSeq, May 2012],</p>

<p>The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding d</p>

<p>caution:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.,function:Location-regulated scaffolding protein connecting MEK to RAF. Promotes MEK and RAF phosphorylation and activity through assembly of an activated signaling complex. By itself, it has no demonstrated kinase activity.,PTM:Phosphorylated on Ser-309 and, to a higher extent, on Ser-404 by MARK3. Dephosphorylated on Ser-404 by PPP2CA. In resting cells, phosphorylated KSR1 is cytoplasmic and in stimulated cells, dephosphorylated KSR1 is membrane-associated.,similarity:Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.,similarity:Contains 1 phorbol-ester/DAG-type zinc finger.,similarity:Contains 1 protein kinase domain.,subcellular location:In unstimulated cells, where the phosphorylated form is bound to a 14-3-3 protein, sequestration in the cytoplasm occurs. Following growth factor treatment, the protein is free for membrane translocation, and it moves from the cytoplasm to the cell periphery.,subunit:Interacts with HSPCA/HSP90, YWHAB/14-3-3, CDC37, MAP2K/MEK, MARK3, PPP2R1A and PPP2CA. Also interacts with RAF and MAPK/ERK, in a Ras-dependent manner (By similarity). The binding of 14-3-3 proteins to phosphorylated KSR prevents the membrane localization.,</p>

<p>p38 MAP kinase (MAPK) is the mammalian orthologue of the yeast HOG kinase that participates in a signaling cascade controlling cellular responses to cytokines and stress. Isoforms p38α, β, γ and δ have been identified. p38 MAPK is activated by a variety of cellular stresses including osmotic shock, inflammatory cytokines, lipopolysaccharide (LPS), UV light, and growth factors.</p>

<p>The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008],</p>

Affinity-purified goat anti-NS/0 HCP. This antibody is part of the NS/0 HCP ELISA Kit (F220).

<p>Affinity-purified goat antibody conjugated to HRP in a protein matrix with preservative, 50 ml, component in the E. coli Western Blot Kit, F415</p>

<p>For use in western blot analysis</p>

For use in ELISA

For use in ELISA. Based on the anti-CHO HCP antibody utilized in CHO HCP ELISA, 3G (F550).

Affinity-purified goat anti-CHO HCP

<p>Component in the A549 HCP Western Blot Kit, F235</p>

Affinity-purified goat anti-PER.C6