Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KREMEN1 antibody
KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
Purity:Min. 95%HGF antibody
HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG
Purity:Min. 95%TEX2 antibody
TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKLPurity:Min. 95%GADD45B antibody
GADD45B antibody was raised using the middle region of GADD45B corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWPurity:Min. 95%WNT5A antibody
WNT5A antibody was raised using the middle region of WNT5A corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTPurity:Min. 95%MAX antibody
MAX antibody was raised in rabbit using the n terminal of MAX as the immunogenPurity:Min. 95%CHIC2 antibody
CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEPurity:Min. 95%NP1 antibody
NP1 antibody was raised in goat using highly pure recombinant human NP-1 as the immunogen.
Purity:Min. 95%GNAI2 antibody
GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLPurity:Min. 95%Persephin antibody
Persephin antibody was raised in rabbit using highly pure recombinant human persephin as the immunogen.Purity:Min. 95%Bend6 antibody
Bend6 antibody was raised in rabbit using the C terminal of Bend6 as the immunogenPurity:Min. 95%ZNF529 antibody
ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogenPurity:Min. 95%SLC25A28 antibody
SLC25A28 antibody was raised using the middle region of SLC25A28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHPurity:Min. 95%FKBP4 antibody
FKBP4 antibody was raised in rabbit using the C terminal of FKBP4 as the immunogen
Purity:Min. 95%ACSL1 antibody
ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGPurity:Min. 95%WDFY3 antibody
WDFY3 antibody was raised in rabbit using the middle region of WDFY3 as the immunogenPurity:Min. 95%POLB antibody
POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLPurity:Min. 95%
