Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NEGR1 antibody
NEGR1 antibody was raised in rabbit using the N terminal of NEGR1 as the immunogen
Purity:Min. 95%C1ORF159 antibody
C1ORF159 antibody was raised using the middle region of C1Orf159 corresponding to a region with amino acids GQSQGALWVCPQTGLPGSGSRPPLPGSPGDPPTRQGQGRIWLVPPALDLSPurity:Min. 95%MAPK13 antibody
MAPK13 antibody was raised in rabbit using the middle region of MAPK13 as the immunogenPurity:Min. 95%Bmp10 antibody
Bmp10 antibody was raised in rabbit using the N terminal of Bmp10 as the immunogenPurity:Min. 95%RP11-217H1.1 antibody
RP11-217H1.1 antibody was raised using the N terminal Of Rp11-217H1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPPurity:Min. 95%Auh antibody
Auh antibody was raised in rabbit using the N terminal of Auh as the immunogenPurity:Min. 95%TRIM27 antibody
TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogenPurity:Min. 95%SSTR2 antibody
SSTR2 antibody was raised in rabbit using the middle region of SSTR2 as the immunogenPurity:Min. 95%RDH12 antibody
RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVPurity:Min. 95%BGN antibody
BGN antibody was raised using the middle region of BGN corresponding to a region with amino acids ISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQPurity:Min. 95%AMH antibody
AMH antibody was raised using the middle region of AMH corresponding to a region with amino acids SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGPurity:Min. 95%ZNF564 antibody
ZNF564 antibody was raised in rabbit using the N terminal of ZNF564 as the immunogenPurity:Min. 95%LOC730950 antibody
LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen
Purity:Min. 95%Mitofusin 2 antibody
Mitofusin 2 antibody was raised using the N terminal of MFN2 corresponding to a region with amino acids STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Purity:Min. 95%C1ORF159 antibody
C1ORF159 antibody was raised using the C terminal Of C1Orf159 corresponding to a region with amino acids PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPVPurity:Min. 95%ANGPTL5 antibody
ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTPurity:Min. 95%RBBP6 antibody
RBBP6 antibody was raised using the N terminal of RBBP6 corresponding to a region with amino acids APPVSGNPSSAPAPVPDITATVSISVHSEKSDGPFRDSDNKILPAAALAS
Purity:Min. 95%AP homeodomain antibody
AP homeodomain antibody was raised in rabbit using Antennapedia homeodomain sequence RQIKIWFQNRRMKWKK as the immunogen.Purity:Min. 95%KIF2A antibody
KIF2A antibody was raised using the C terminal of KIF2A corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDPurity:Min. 95%WDR33 antibody
WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL
Purity:Min. 95%
