Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
IL18 antibody
IL18 antibody is a monoclonal antibody that targets interleukin-18 (IL-18), a pro-inflammatory cytokine involved in immune responses. This antibody specifically binds to IL-18, inhibiting its activity and reducing inflammation. IL18 antibody has been shown to have an inhibitory effect on collagenase and glycogen synthase kinase, α subunit, which are enzymes involved in tissue degradation and inflammation. It can be used in various applications in Life Sciences research, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). IL18 antibody is also used to study the role of IL-18 in diseases such as cancer and autoimmune disorders. Whether you need a highly specific monoclonal antibody or polyclonal antibodies for your research, IL18 antibody is a valuable tool for studying the function of IL-18 and its impact on various biological processes.
MMP16 antibody
The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.
Goat anti Mouse IgM (Fab'2) (HRP)
Goat anti-mouse IgM (Fab'2) (HRP) was raised in goat using murine IgM mu heavy chain as the immunogen.Purity:Min. 95%Florfenicol Amine antibody
Florfenicol Amine antibody is a powerful tool for detecting and studying the expression of forskolin in various samples. It is a polyclonal antibody that specifically binds to forskolin, a potent activator of adenylate cyclase. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and ELISA.Purity:Min. 95%Helicobacter pylori antibody (CagA protein)
Mouse monoclonal CagA protein antibody (Helicobacter pylori)YARS antibody
YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE
Mycophenolic Acid antibody
Mycophenolic Acid antibody is a powerful tool used in Life Sciences research. It specifically targets and binds to various proteins, including β-catenin, dopamine, TNF-α, tyrosine kinase receptors, phosphatases, and nuclear factors. This antibody exhibits cytotoxic activity against cells expressing these proteins and has been extensively used in studies involving antigen detection and antibody-drug conjugates. Mycophenolic Acid antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and affinity make it an essential component in many research applications.Purity:Min. 95%Fibronectin antibody (biotin)
Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.
TOMM70A antibody
TOMM70A antibody was raised in rabbit using the N terminal of TOMM70A as the immunogen
Goat anti Human IgG (Fab'2) (HRP)
Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.Purity:Min. 95%RGS16 antibody
RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
