Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
KCNC1 antibody
KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
Ubiquilin 3 antibody
Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
TNFAIP8L1 antibody
TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL
DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.DDX27 antibody
DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DEKIEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSE
Albendazole antibody
The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.
Purity:Min. 95%FABP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. By acting as a bactericidal agent, this drug effectively inhibits the replication and transcription of DNA-dependent RNA polymerase, preventing the spread of tuberculosis.ABCC1 antibody
The ABCC1 antibody is a polyclonal antibody that specifically targets the ABCC1 protein. This protein plays a crucial role in multidrug resistance and is involved in the transport of various substances across cell membranes. The ABCC1 antibody has been shown to neutralize the activity of ABCC1, making it an effective tool for studying the function of this protein.
WNT2B antibody
WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
SCD antibody
SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
EMID1 antibody
EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
Purity:Min. 95%Cystatin B antibody
The Cystatin B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Cystatin B, a fatty acid-binding protein involved in various cellular processes. This antibody is particularly useful for studying the role of Cystatin B in interferon-activated pathways, endocytic uptake mechanisms, and low-density lipoprotein metabolism.
