Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
HTR1A antibody
HTR1A antibody was raised in rabbit using the N terminal of HTR1A as the immunogen
Purity:Min. 95%WDR1 antibody
WDR1 antibody was raised using the C terminal of WDR1 corresponding to a region with amino acids LAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDE
CD11c antibody (FITC)
CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Purity:Min. 95%KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
PLOD2 antibody
PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
Purity:Min. 95%CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
Goat anti Rabbit IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%Pneumolysin antibody
Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.
Purity:Min. 95%DDX39 antibody
DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)
