Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
Donkey anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%SERCA1 antibody
The SERCA1 antibody is an active agent that is commonly used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to SERCA1, a low-density protein found in various cells including MCF-7 cells. This antibody is often used in research studies to investigate the role of SERCA1 in different cellular processes.
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
CD44 antibody (Spectral Red)
CD44 antibody (Spectral Red) was raised in mouse using chicken CD44 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCdk3 antibody
The Cdk3 antibody is a monoclonal antibody that specifically targets and binds to sclerostin, a protein involved in the regulation of bone metabolism. This antibody has been extensively validated in various assays, including colloidal gold immunolabeling and nuclear staining. It has been widely used in research studies within the Life Sciences field to investigate the role of sclerostin in bone development and diseases such as osteoporosis.
RP11-529I10.4 antibody
RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD
Cdc25C antibody
Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.
anti-Salmonella Typhimurium LPS Monoclonal
Monoclonal antibody to Salmonella typhimurium (LPS-lipopolysaccharide).Purity:Min. 95%Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
