Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Aggrecan antibody
The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.
BOP1 antibody
BOP1 antibody was raised using the N terminal of BOP1 corresponding to a region with amino acids MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDS
Calretinin antibody
The Calretinin antibody is a highly reactive monoclonal antibody that targets the growth factor calretinin. Calretinin is a protein that contains numerous acid residues and is primarily found in mesothelial cells. This antibody has been extensively validated using techniques such as polymerase chain reaction (PCR) and immunohistochemistry to ensure its specificity and reliability.
HDAC2 antibody
The HDAC2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects hepatocyte growth factor (HGF), fibronectin, collagen, and other important proteins. This antibody is widely used in research laboratories for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It can be used to study the expression and localization of HGF and other proteins in different tissues and cell types. The HDAC2 antibody is also commonly used in drug discovery and development to evaluate the effect of potential inhibitors on protein complexes involved in growth factor signaling pathways. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of cell biology, molecular biology, and drug development.
Cdk7 antibody
Cdk7 antibody was raised in mouse using recombinant C-terminal 221 aa fragment of human wild-type cdk7/CAK (cyclin activating kinase) as the immunogen.
Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.TAP antibody
The TAP antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both monoclonal and polyclonal forms, making it suitable for a wide range of applications. This antibody is specifically designed to target and neutralize epidermal growth factor (EGF) and hepatocyte growth factor (HGF), two important growth factors involved in various biological processes.
LZTFL1 antibody
LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Ubiquilin 1 antibody
The Ubiquilin 1 antibody is a powerful diagnostic biomarker used in Life Sciences. This antibody specifically targets caveolin-1, a protein involved in various cellular processes. It can be utilized in cdna microarray experiments to study the expression levels of caveolin-1 and its associated proline-rich proteins. The Ubiquilin 1 antibody is also valuable for cellular immunotherapy research, as it aids in the detection and quantification of interferon emissions. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in the field of Life Sciences. Trust the Ubiquilin 1 antibody to deliver accurate results and contribute to groundbreaking discoveries in medicine.
Amphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.
