Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Calreticulin antibody
Calreticulin antibody is a polyclonal antibody that acts as an inhibitor of growth factors. It specifically targets low-density lipoprotein receptors and alpha-synuclein, two molecules that play a crucial role in cellular growth and development. Additionally, this antibody has been shown to bind to epidermal growth factor and trastuzumab, both monoclonal antibodies used in cancer treatment. By binding to these molecules, the calreticulin antibody prevents their interaction with nucleotide molecules, inhibiting nuclear signaling and ultimately suppressing cell growth. Furthermore, it exhibits anti-HER2 activity by blocking the amino group of epidermal growth factor receptors. With its multifaceted mechanisms of action, the calreticulin antibody holds promise for various therapeutic applications.
KBTBD10 antibody
KBTBD10 antibody was raised in rabbit using the N terminal of KBTBD10 as the immunogen
Purity:Min. 95%VMAT2 antibody
The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.
NAGS antibody
NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
AML1 antibody
The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.
Calpain 10 antibody
Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC
SCRT2 antibody
SCRT2 antibody was raised in rabbit using the middle region of SCRT2 as the immunogenPurity:Min. 95%V5 Tag antibody
The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
CD25 antibody
CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.
PPIF antibody
PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
