Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
NSUN4 antibody
NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
Desmoplakin 1+2 antibody
Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.
KLC3 antibody
KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
RAB39A antibody
The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.
TNFSF15 antibody
TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.
CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
Carbonyl Reductase 1 antibody
Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Somatostatin antibody
Somatostatin antibody was raised in sheep using somatostatin conjugated to carrier protein as the immunogen.
PGK1 antibody
PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR
