Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
P38 MAPK antibody
The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.
Purity:Min. 95%PPIA antibody
The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.
DPPA5 antibody
DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
GLP1 antibody
The GLP1 antibody is a highly effective inhibitor that targets human serum and inhibitory factors, such as leukemia inhibitory factor. It is an antibody specifically designed to neutralize the activity of GLP1, which is a hormone peptide involved in various physiological processes. This monoclonal antibody has been extensively studied and proven to be cytotoxic against specific cell types. Its unique mechanism of action involves binding to GLP1 receptors and interfering with downstream signaling pathways. The GLP1 antibody has shown promising results in preclinical studies and holds great potential for therapeutic applications in the field of Life Sciences.SSBP3 antibody
SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP
TACC3 antibody
The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.
