Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Goat anti Rabbit IgG (H + L) (FITC)
Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.
p73 antibody
The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
Purity:Min. 95%p53 antibody
The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.
Purity:Min. 95%CYP2A13 antibody
CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF
FUS antibody
The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.
GABABR2 antibody
GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.
Purity:Min. 95%CD45RO antibody
The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.
Cdc25C antibody
Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.
Human Serum Albumin antibody
Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.
CHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%
