Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
GRPEL1 antibody
GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
GPT Antibody
The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.Purity:Min. 95%STAT3 antibody
The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
Purity:Min. 95%Goat anti Rat IgM (FITC)
Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.
Purity:Min. 95%FUS antibody
The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.
HHIPL1 antibody
HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen
Purity:Min. 95%HCG beta Antibody
The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.
GFPT2 antibody
GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen
Purity:Min. 95%Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific
Purity:Min. 95%Epor antibody
Epor antibody was raised in rabbit using the N terminal of Epor as the immunogen
Purity:Min. 95%CD45RO antibody
The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.
Arginase 2 antibody
Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
Cystatin C antibody
Cystatin C antibody is a highly specialized product used in the field of Life Sciences. It is a microparticle that forms an acid complex with cystatin C, a protein found in the body. This antibody is designed to specifically target and bind to cystatin C, allowing for its detection and measurement in various research applications.P38 MAPK antibody
The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.
Purity:Min. 95%
