Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
IL8 antibody
The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.
GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%P2Y2 antibody
P2Y2 antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human P2Y2 protein as the immunogen.Purity:Min. 95%PGK1 antibody
PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR
CTNNB1 antibody
The CTNNB1 antibody is a monoclonal antibody that specifically targets the CTNNB1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion, signal transduction, and gene expression. The CTNNB1 antibody has been extensively studied and shown to be highly specific and sensitive in detecting CTNNB1 in various biological samples.
RhoA antibody
The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.
PNMT antibody
The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.
EphB1 antibody
EphB1 antibody was raised in Mouse using a purified recombinant fragment of EphB1(aa19-133) expressed in E. coli as the immunogen.
NRIP1 antibody
NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)SOCS3 antibody
The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
RARA antibody
The RARA antibody is a neutralizing monoclonal antibody that targets the endothelial growth factor. It has been shown to inhibit the growth and proliferation of cells involved in angiogenesis, making it a promising therapeutic option for various diseases related to abnormal blood vessel formation. This antibody specifically binds to fibronectin and collagen, forming a protein complex that disrupts the signaling pathways involved in angiogenesis. In addition, the RARA antibody has been found to have inhibitory effects on alpha-fetoprotein, a growth factor associated with certain types of cancer. Its potential applications in the field of life sciences make it an exciting area of research and development.
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
