Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
LOC344065 antibody
LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen
Purity:Min. 95%ACTH antibody
Adrenocorticotropic Hormone antibody was raised in rabbit using synthetic ACTH as the immunogen.Purity:Min. 95%ZNF319 antibody
ZNF319 antibody was raised in rabbit using the N terminal of ZNF319 as the immunogenPurity:Min. 95%mGLUR2 antibody
The mGLUR2 antibody is a monoclonal antibody that specifically targets the metabotropic glutamate receptor 2 (mGLUR2). This receptor plays a crucial role in various physiological and pathological processes, including neuronal signaling, synaptic plasticity, and neurodegenerative diseases. The mGLUR2 antibody binds to the receptor and modulates its activity, leading to changes in cellular responses.
Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.Hamster Lymphocyte antibody
Hamster lymphocyte antibody was raised in rabbit using RBC-free hamster thymus and spleen cells as the immunogen.Purity:Min. 95%U1SNRNPBP antibody
U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
KRT14 antibody
KRT14 antibody was raised in rabbit using the C terminal of KRT14 as the immunogen
Purity:Min. 95%Rabbit anti Human IgA
Rabbit anti-human IgA was raised in rabbit using human IgA alpha heavy chain as the immunogen.Purity:Min. 95%Borrelia burgdorferi antibody
Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Purity:Min. 95%WEE1 antibody
The WEE1 antibody is a reactive monoclonal antibody that specifically binds to erythropoietin (EPO) and its receptor. It has been shown to inhibit the activation of the EPO receptor, preventing downstream signaling events. This antibody can be used in various applications, including immunoassays and immunohistochemistry, to detect and quantify EPO levels in human serum or tissue samples. The WEE1 antibody can also be immobilized on a colloidal electrode for use in biosensors or other diagnostic devices. Its high affinity and specificity make it a valuable tool for researchers in the field of life sciences studying EPO and its associated binding proteins.
CHIT1 antibody
CHIT1 antibody was raised in Mouse using a purified recombinant fragment of CHIT1(aa22-137) expressed in E. coli as the immunogen.
LDL Receptor antibody
LDL receptor antibody was raised in rabbit using a synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.
Purity:Min. 95%
