
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,472 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38263 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molH-Glu-Ala-pNA
CAS:<p>Please enquire for more information about H-Glu-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H18N4O6Purity:Min. 95%Molecular weight:338.32 g/molZ-Lys-Leu-OH
CAS:<p>Please enquire for more information about Z-Lys-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H31N3O5Purity:Min. 95%Molecular weight:393.48 g/molH-Ala-Pro-Val-EDANS
CAS:<p>Please enquire for more information about H-Ala-Pro-Val-EDANS including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H35N5O6SPurity:Min. 95%Molecular weight:533.64 g/molH-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%(Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-His(Bzl)6,D-Leu7,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molL-m-Tyrosine
CAS:<p>L-m-Tyrosine is a nonessential amino acid that is synthesized from phenylalanine. It has been shown to have antioxidant properties and protects against oxidative injury by scavenging reactive oxygen species such as hydrogen fluoride. L-m-Tyrosine has also been shown to modulate dopamine levels in the brain and may be used in the treatment of Parkinson's disease. The biological effects of L-m-Tyrosine are mediated through the transcriptional regulation of genes encoding proteins involved in dopamine β-hydroxylase and hydrogen fluoride detoxification. L-m-Tyrosine is also an experimental model for studying drug resistance in bacteria, including methicillin resistant Staphylococcus aureus (MRSA).</p>Formula:C9H11NO3Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:181.19 g/molMyelin Proteolipid Protein (139-151) (depalmitoylated) (human, bovine, dog, mouse, rat) trifluoroacetate salt
CAS:<p>MPLP(139-151) is a peptide that is derived from the myelin proteolipid protein (PLP). MPLP(139-151) has been shown to inhibit macrophage inflammatory in vitro and brain inflammation in vivo. The inhibition of macrophages was mediated by the induction of apoptosis and inhibition of NF-κB. MPLP(139-151) also induced regression of experimental autoimmune encephalomyelitis in mice, which suggests that it might be useful as a therapeutic agent for multiple sclerosis or other inflammatory diseases.</p>Formula:C72H104N20O16SPurity:Min. 95%Molecular weight:1,537.79 g/molH-Pro-His-Phe-OH
CAS:<p>H-Pro-His-Phe-OH is a proteolytic enzyme that belongs to the group of serine proteases. It is a member of the subtilisin family and has been used in research for its ability to cleave proteins at random. H-Pro-His-Phe-OH has been shown to hydrolyze lactococcal proteinase and other serine proteases, such as trypsin, chymotrypsin, and elastase.</p>Formula:C20H25N5O4Purity:Min. 95%Molecular weight:399.44 g/molBoc-Gly-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt
CAS:<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H95ClN20O12Purity:Min. 95%Molecular weight:1,323.98 g/mol2-Methoxy estrone
CAS:Controlled Product<p>2-Methoxy estrone is a metabolite of estrone and is produced by the enzyme 2-hydroxylase. This compound has minimal toxicity and can be used as a marker for biological processes, such as cellular transformation. 2-Methoxy estrone has been shown to inhibit the activity of acetylcholinesterase, an enzyme that breaks down acetylcholine, which is essential for neurotransmission. It has also been implicated in the regulation of angiogenic processes in vitro and in vivo. The role of 2-methoxy estrone in cancer cells is not fully understood but it may have potential as a biomarker for prostate cancer and breast cancer.</p>Formula:C19H24O3Purity:(%) Min. 95%Color and Shape:PowderMolecular weight:300.39 g/molAcetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C107H170N32O21Purity:Min. 95%Molecular weight:2,240.7 g/molH-Met-Ile-OH
CAS:<p>H-Met-Ile-OH is an atypical antipsychotic drug that has been shown to have the ability to block dopamine receptors. This compound has been shown to be a secretagogue, which means it can stimulate the secretion of other hormones or peptides. H-Met-Ile-OH may also regulate the activity of regulatory subunit proteins and affect the regulation of other genes. It has been shown to have diagnostic utility in the diagnosis of atypical mutations in women. The frequency and spectrum of H-Met-Ile-OH attacks are determined by genotype and nucleotide polymorphisms.</p>Formula:C11H22N2O3SPurity:Min. 95%Molecular weight:262.37 g/molH-D-Phe-D-Phe-OH
CAS:<p>H-D-Phe-D-Phe-OH is a polypeptide that contains 24 amino acids. It is synthesized by the filamentous fungus, Aspergillus niger, and has been found to be an optimal substrate for aminopeptidase. H-D-Phe-D-Phe-OH has also been shown to be a homolog of the halophilic enzyme from Halobacterium salinarum.</p>Formula:C18H20N2O3Purity:Min. 95%Molecular weight:312.36 g/molL-allo-Threoninol
CAS:<p>Please enquire for more information about L-allo-Threoninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C4H11NO2Purity:Min. 95%Color and Shape:Colourless To Pale Yellow LiquidMolecular weight:105.14 g/molCyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala)
CAS:<p>Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) is a cyclic peptide that has a conformational interaction with fibrinogen. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) binds to the FGA binding site on fibrinogen, preventing the formation of the fibrin clot. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) has been shown to activate platelets, which may be due to its ability to increase levels of cAMP and activate protein kinase A. Cyclo(-Gly-Arg-Gly-Asp-) also has an affinity for monoclonal antibodies, which may be due to its high molecular electrostatic potential or its synthetic nature.</p>Formula:C25H40N10O10Purity:Min. 95%Molecular weight:640.65 g/molH-D-Val-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-D-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Phe-Pro-Ala-pNA
CAS:<p>Please enquire for more information about H-Phe-Pro-Ala-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H27N5O5Purity:Min. 95%Molecular weight:453.49 g/molAdipokinetic Hormone G (Gryllus bimaculatus)
CAS:<p>Adipokinetic hormone G is a peptide found in the hemolymph of Gryllus bimaculatus, a species of cricket. It has been shown to have anti-lipemic and antilipaemic effects in animal models. Adipokinetic hormone G can be detected by bioassay and matrix-assisted laser desorption/ionization (MALDI) mass spectrometry.</p>Formula:C43H57N11O12Purity:Min. 95%Molecular weight:919.98 g/mol((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin
<p>Please enquire for more information about ((R)-4-Hydroxy-4-methyl-Orn (5-TAMRA)7)-Phalloidin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H69N11O14SPurity:Min. 95%Molecular weight:1,200.32 g/mol1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin
CAS:<p>Please enquire for more information about 1-t-Boc-piperidine-4-spiro-5'-[1',3'-bis-t-boc]-hydantoin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H35N3O8Purity:Min. 95%Molecular weight:469.53 g/mol7-Methoxy-4-(trifluoromethyl)coumarin
CAS:<p>7-Methoxy-4-(trifluoromethyl)coumarin is a potent and selective aromatase inhibitor. It inhibits the activity of the enzyme, which converts testosterone to estradiol. The inhibition of this enzyme may be beneficial in the treatment of breast cancer. This compound has also been shown to inhibit the activity of P450 enzymes and coumarin derivatives, which are involved in drug metabolism and detoxification.</p>Formula:C11H7F3O3Purity:Min. 95%Molecular weight:244.17 g/molH-Gly-Glu-Gly-OH trifluoroacetic acid
CAS:<p>H-Gly-Glu-Gly-OH trifluoroacetic acid is a dilute buffer solution of amino acids. It has been used to study the thermodynamic stability of polypeptides and their sensitivity to acidic conditions. Experiments have shown that H-Gly-Glu-Gly-OH trifluoroacetic acid is more stable than glycine, glutamic acid, histidine, aspartic acid, or aspartyl. This compound is an amino acid with a high concentration of glutamic acid.</p>Formula:C9H15N3O6•(CF3CO2H)xPurity:Min. 95%Molecular weight:261.23 g/molH-Met-Lys-OH formiate salt
CAS:<p>H-Met-Lys-OH formiate salt is an industrial chemical that can be used in the preparation of pharmaceutical preparations. It has been shown to have a potential to lower blood pressure and reduce the risk of cardiovascular diseases. H-Met-Lys-OH formiate salt is a lysine derivative that contains two amino acid residues, namely lysine and methionine. H-Met-Lys-OH formiate salt can be used as a therapeutic agent for prostate cancer by targeting tp53 mutations and radical prostatectomy. It can also be used as an antibacterial agent against gram-negative bacteria, such as Escherichia coli (E. coli).</p>Formula:C11H23N3O3SPurity:Min. 95%Molecular weight:277.38 g/molH-Lys-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Lys-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N6O5Purity:Min. 95%Molecular weight:388.46 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C30H41N9O9Purity:Min. 95%Molecular weight:671.7 g/molMet-Lys-Bradykinin
CAS:<p>Met-Lys-Bradykinin is a synthetic peptide with the amino acid sequence Met-Lys-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg. It has been shown to have cytosolic Ca2+ release activity, protease activity, and vasodilator activities. The peptide also has binding affinity for human immunoglobulin G (IgG) and is able to form complexes with soybean trypsin.</p>Formula:C61H94N18O13SPurity:Min. 95%Molecular weight:1,319.58 g/molBoc-Gly-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Gly-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Tyr-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Tyr-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H24N6O3·2HClPurity:Min. 95%Molecular weight:409.31 g/molFor-Met-Leu-Phe-OMe
CAS:<p>For-Met-Leu-Phe-OMe is a drug that has been shown to have anti-inflammatory properties in human cells. For-Met-Leu-Phe-OMe inhibits the production of inflammatory molecules, such as gamma-aminobutyric acid, and it also blocks the binding of leukotrienes to their receptors. These effects are due to its conformational properties, which allow it to bind to the receptor site and inhibit the binding of other molecules. For-Met-Leu-Phe-OMe has been shown to enhance the release of nucleotide levels and intracellular calcium concentration in vitro. It also binds to receptors on cells, which may be due to its biochemical properties or its analogues with other drugs.</p>Formula:C22H33N3O5SPurity:Min. 95%Molecular weight:451.58 g/molAxltide trifluoroacetate salt
CAS:<p>Please enquire for more information about Axltide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C63H107N19O20S2Purity:Min. 95%Molecular weight:1,514.77 g/molHIV (gp120) Fragment (308-331)
CAS:<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>Formula:C114H199N41O31Purity:Min. 95%Molecular weight:2,640.06 g/molZ-Tyr-Leu-OH
CAS:<p>Please enquire for more information about Z-Tyr-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H28N2O6Purity:Min. 95%Molecular weight:428.48 g/molBoc-Thionoleu-1-(6-nitro)benzotriazolide
CAS:<p>Please enquire for more information about Boc-Thionoleu-1-(6-nitro)benzotriazolide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O4SPurity:Min. 95%Molecular weight:393.46 g/molLauroyl lysine
CAS:<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>Formula:C18H36N2O3Purity:99.18%Color and Shape:White To Off-White Solid With Characteristic Faint OdorMolecular weight:328.49Fmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Formula:C21H22N4O4Purity:Min. 95%Molecular weight:394.42 g/molBoc-Phe-D-Leu-Phe-D-Leu-Phe-OH
CAS:<p>Polymyxin B is a cationic detergent that binds to bacterial membranes and destroys the cell wall. Polymyxin B has been shown to be a potent antagonist of spermatozoa and microglia, which are cells that maintain the homeostasis of the central nervous system. It also has been shown to be an inhibitor of chemotaxis in polymorphonuclear leucocytes (PMN), which are white blood cells that participate in inflammatory processes. Polymyxin B has been shown to have chemotactic activity for PMN and inhibit protein synthesis in mitochondria. This compound also inhibits chelerythrine, a cyclase inhibitor that is used as an antineoplastic agent.</p>Formula:C44H59N5O8Purity:Min. 95%Molecular weight:785.97 g/molpTH (73-84) (human)
CAS:<p>Please enquire for more information about pTH (73-84) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H96N16O19Purity:Min. 95%Molecular weight:1,273.44 g/molBrain Injury Derived Neurotrophic Peptide
CAS:<p>Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala-Arg-Gly-Ala-Ile-Phe-Gln-Ala-NH2 is a growth factor that has been shown to have antiinflammatory and immunosuppressive effects in autoimmune diseases. It also has the ability to bind to peptides, proteins, and particle surfaces. This peptide has been shown to be effective against cancer cells by inhibiting tumor growth and increasing the effectiveness of radiation therapy. Brain Injury Derived Neurotrophic Peptide H-Glu-Ala-Leu-Glu-Leu-Ala Arg Gly Ala Ile Phe Gln Ala NH2 is also an immunosuppressant that can reduce inflammation caused by infectious diseases such as HIV/AIDS.</p>Formula:C62H102N18O18Purity:Min. 95%Molecular weight:1,387.58 g/molZ-Gly-Pro-Gly-Gly-Pro-Ala-OH
CAS:<p>Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is a synthetic substrate. It is used in tissue culture to measure collagenase activity, as well as in skin cells to measure the activity of v. anguillarum. The optimum pH for this substrate is 5.5 and it has been shown to be stable in high salt environments. This substrate also reacts with human liver granulosa cells and has been shown to have neutral pH properties. Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is an enzyme substrate that is involved in many different enzyme activities including protein synthesis and hydrogen bonding.</p>Formula:C27H36N6O9Purity:Min. 95%Molecular weight:588.61 g/mol(Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molHIV-1 gag Protein p17 (76-84) acetate salt
CAS:<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>Formula:C44H72N10O15Purity:Min. 95%Molecular weight:981.1 g/molHIV-1 rev Protein (34-50)
CAS:<p>Please enquire for more information about HIV-1 rev Protein (34-50) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H173N51O24Purity:Min. 95%Molecular weight:2,437.74 g/molH-Ala-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Ala-Pro-Ala-OH is a tetrapeptide that inhibits elastase, an enzyme that breaks down elastin. This compound has been shown to have anti-elastolytic activity in vitro and in vivo. H-Ala-Ala-Pro-Ala-OH was administered intraperitoneally to hamsters with induced emphysema, resulting in a decrease of elastin abnormalities and improvement of the ultrastructure of the lungs. It also improves pancreatic morphology and function in porcine pancreatitis models.</p>Formula:C14H24N4O5Purity:Min. 95%Molecular weight:328.36 g/molFmoc-N-(4-boc-aminobutyl)glycine
CAS:<p>Please enquire for more information about Fmoc-N-(4-boc-aminobutyl)glycine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H32N2O6Purity:Min. 95%Molecular weight:468.54 g/molAc-Trp-Glu-His-Asp-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C38H37F3N8O11Purity:Min. 95%Molecular weight:838.74 g/mol2-(Boc-Aminomethyl)pyrrolidine
CAS:<p>Please enquire for more information about 2-(Boc-Aminomethyl)pyrrolidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N2O2Purity:Min. 95%Molecular weight:200.28 g/molBz-D-Thr-OMe
CAS:<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>Formula:C12H15NO4Purity:Min. 95%Molecular weight:237.25 g/molBz-Asn-Gly-Thr-NH2
CAS:<p>Please enquire for more information about Bz-Asn-Gly-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H23N5O6Purity:Min. 95%Molecular weight:393.39 g/molJKC-301 Cyclo(-D-Asp-Pro-D-Ile-Leu-D-Trp)
CAS:<p>Please enquire for more information about JKC-301 Cyclo(-D-Asp-Pro-D-Ile-Leu-D-Trp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H44N6O7Purity:Min. 95%Molecular weight:624.73 g/molMetorphamide (free acid)
CAS:<p>Please enquire for more information about Metorphamide (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H68N14O10SPurity:Min. 95%Molecular weight:985.17 g/molAc-Met-AMC
CAS:<p>Ac-Met-AMC is a nucleoside analog that is an active inhibitor of the enzyme DNA polymerase. This drug has been shown to be effective in preventing the growth of cancer cells in tissue cultures, and it has also been used to study the relationship between isoforms and oxygenated species. Ac-Met-AMC binds to the cytosolic side of the enzyme, which reduces its activity, but this binding does not affect the enzyme's ability to bind substrate or ATP. Ac-Met-AMC has been shown to hydrolyze with a rate constant of 6 x 10 M(-1) s(-1).</p>Formula:C17H20N2O4SPurity:Min. 95%Molecular weight:348.42 g/molH-Tyr-Glu-Trp-OH
CAS:<p>Tyrosine is a non-essential amino acid that is an important component of proteins. It can also be synthesized in the body from the essential amino acid phenylalanine. Tyrosine is found in many foods and is made by plants, bacteria, and animals. The most common form of tyrosine in food is L-tyrosine. H-Tyr-Glu-Trp-OH is a neurotrophic factor that interacts with tyrosine kinase receptors to promote neuron survival and function. H-Tyr-Glu-Trp-OH has been shown to have neuroprotective effects in neonatal rats, preventing neuronal death due to genetic ablation or biochemical inhibition of neurotransmitter release.<br>Synaptic transmission refers to the propagation of nerve impulses across synapses, which are gaps between neurons. Neurotrophic factors are proteins produced by neurons that regulate the growth and maintenance of neurons.END> END></p>Formula:C25H28N4O7Purity:Min. 95%Molecular weight:496.51 g/mol(D-Ala2)-Leu-Enkephalin amide
CAS:<p>Hyaluronic acid is a natural component of connective tissue and synovial fluid in animals. It is a linear, unbranched polysaccharide consisting of alternating D-glucuronic acid and N-acetyl-D-glucosamine. Hyaluronic acid has been shown to be useful in the treatment of long-term diseases such as heart disease or skin conditions like eczema. It is important for the efficient production of vaccines, which are used to prevent infectious diseases such as streptococcal infections. Hyaluronic acid can also be used as a microcontroller for minimally invasive procedures. This molecule can be used as an additive in the production of metallocene catalysts to increase the efficiency of these reactions, while reducing impurities during the process. The use of hyaluronic acid has been studied extensively, with many techniques employed to study its properties and functions. Genetic factors have also been found to play a role in</p>Formula:C29H40N6O6Purity:Min. 95%Molecular weight:568.66 g/molH-Lys-Leu-OH·HBr
CAS:<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H25N3O3·HBrPurity:Min. 95%Molecular weight:340.26 g/molAc-Asp-Tyr(PO3H2)-Val-Pro-Met-Leu-NH2
CAS:<p>Please enquire for more information about Ac-Asp-Tyr(PO3H2)-Val-Pro-Met-Leu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C36H56N7O13PSPurity:Min. 95%Molecular weight:857.91 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS:<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H66D5N13O12Purity:Min. 95%Molecular weight:1,051.21 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Val-Val-Val-Val-OH
CAS:<p>Please enquire for more information about H-Val-Val-Val-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H38N4O5Purity:Min. 95%Molecular weight:414.54 g/molCyclo(-D-Ala-Val)
CAS:<p>Please enquire for more information about Cyclo(-D-Ala-Val) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O2Purity:Min. 95%Molecular weight:170.21 g/molCortistatin-29 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-29 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H223N47O42S3Purity:Min. 95%Molecular weight:3,440.85 g/molBoc-4-carboxymethyl-piperidine
CAS:<p>Boc-4-carboxymethyl-piperidine is a novel drug that has been shown to have significant correlations with the inhibition of fibrinogen and cellulose. It also has the ability to inhibit arsenite, which may be due to its dithiocarbamate group. Boc-4-carboxymethyl-piperidine has been shown to have significant biological activity in vitro. This molecule has been synthesized and crystallized, and x-ray data have been collected. The molecular structure of this molecule is shown below:</p>Formula:C12H21NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:243.3 g/molH-β-Ala-Trp-OH
CAS:<p>Please enquire for more information about H-beta-Ala-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H17N3O3Purity:Min. 95%Molecular weight:275.3 g/mol2-Hydroxy-5-[(4-{[(6-methoxypyridazin-3-yl)amino]sulfonyl}phenyl)diazenyl]benzoic acid
CAS:<p>Used in treatment of nonspecific ulcerative colitis</p>Formula:C18H15N5O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:429.41 g/molRF9 trifluoroacetate salt
CAS:<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>Formula:C26H38N6O3Purity:Min. 95%Molecular weight:482.62 g/molAc-Asp-Arg-Leu-Asp-Ser-OH
CAS:<p>Ac-Asp-Arg-Leu-Asp-Ser-OH is a peptide that has been synthesized to mimic the activity of aspartic acid. It has been shown to have prophylactic and/or therapeutic effects on infectious diseases and autoimmune diseases. Ac-Asp-Arg-Leu-Asp-Ser-OH may be used for the treatment of cancer, inflammatory diseases, and neurodegenerative diseases. Ac-Asp-Arg-Leu-Asp-Ser OH also acts as a cryoprotectant and diluent in drug development.</p>Formula:C25H42N8O12Purity:Min. 95%Molecular weight:646.65 g/mol(R)-1-Boc-3-Aminopyrrolidine
CAS:<p>(R)-1-Boc-3-Aminopyrrolidine is a small molecule that inhibits 3-kinase. It has been shown to bind to the ATP binding site of PI3Kδ and inhibit its activity. This results in the inhibition of phosphoinositide production, which leads to decreased cell proliferation and survival. (R)-1-Boc-3-Aminopyrrolidine has also been shown to have selectivity for isoform α over β, γ, and δ. The drug binds specifically to the ATP binding site on PI3Kδ, but does not disrupt other interactions such as hydrogen bonding or pi stacking interactions with residues in the vicinity of the ATP binding site. The IC50 values for (R)-1-Boc-3-Aminopyrrolidine were determined using siRNA knockdown experiments against human isoform α PI3Kδ.</p>Formula:C9H18N2O2Purity:Min. 95%Molecular weight:186.25 g/molC5a Anaphylatoxin (37-53) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about C5a Anaphylatoxin (37-53) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C82H141N27O22SPurity:Min. 95%Molecular weight:1,889.23 g/molFmoc-Ile-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%4-Phenyl-piperidine
CAS:<p>4-Phenyl-piperidine is a nitro compound that has been shown to be toxic for the kidneys and nervous system. 4-Phenyl-piperidine has been shown to inhibit dopamine uptake in the striatum and locomotor activity in rats. It also inhibits the hydrolysis of hydrochloric acid, which produces hydrogen ion (H+) ions, resulting in an acidic environment. The chemical structures of 4-phenyl-piperidine are similar to those of tricyclic antidepressants drugs, such as amitriptyline and imipramine, with a phenyl ring attached to an amine group. This drug is used as a pharmaceutical preparation for treating depression by inhibiting the reuptake of serotonin and norepinephrine, which are neurotransmitters that affect mood.</p>Formula:C11H15NPurity:Min. 95%Molecular weight:161.24 g/molBoc-Gly-Gly-Gly-Lys-OH
CAS:<p>Please enquire for more information about Boc-Gly-Gly-Gly-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H31N5O7Purity:Min. 95%Molecular weight:417.46 g/molFmoc-Ser(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ser(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH
CAS:<p>H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-Tyr-Thr-Ala-Arg-Gly-OH is a synthetic peptide that has been shown to have a homologous sequence with the amino acid sequence of a primary tumor. This peptide has strong binding affinity to tyrosine kinase, which is an enzyme involved in cellular signal transduction. H-Arg-Arg-Leu-Ile-Glu-Asp-Asn Glu Tyr Thr Ala Arg Gly OH has been shown to inhibit the growth of tumors and can be used as an analytical method for identifying carcinoma cells in vitro. HAAGLTEIGDATASNTTAHARGLTRALAGRGGYOH is also a potential drug for cardiovascular diseases, as it can be taken up intracellularly and may inhibit the proliferation of vascular smooth muscle cells.</p>Formula:C66H109N23O23Purity:Min. 95%Molecular weight:1,592.71 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H51N3O4·HClPurity:Min. 95%Molecular weight:506.16 g/molH-Met-Gly-OH
CAS:<p>H-Met-Gly-OH is a radical scavenger that has been shown to have potent antioxidant properties. It is an amide with two nitrogen atoms and can be used as a marker protein in human serum, where it binds to fatty acids and inhibits the formation of free radicals. H-Met-Gly-OH has been shown to chelate metal ions such as copper, iron, and zinc. The uptake of these metal ions by the human body may cause genotoxic effects or other toxic reactions, which can be prevented by using H-Met-Gly-OH as a chelating agent. This compound also has broad spectrum antimicrobial activity against microbes that are resistant to many antibiotics.</p>Formula:C7H14N2O3SPurity:Min. 95%Molecular weight:206.26 g/molFmoc-ε-aminocaproic acid-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:<p>Please enquire for more information about Boc-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H32N4O4Purity:Min. 95%Molecular weight:344.45 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molH-Arg-Asn-NH2 sulfate salt
CAS:<p>Please enquire for more information about H-Arg-Asn-NH2 sulfate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H21N7O3Purity:Min. 95%Molecular weight:287.32 g/mol6-Chloro-2-methylbenzoic acid
CAS:<p>6-Chloro-2-methylbenzoic acid is a methyl ester that is used in the synthesis of 2-chloro-6-fluorobenzaldehyde. This chemical reacts with hydrogen peroxide to produce chloride and 2,6-dichlorobenzoic acid. The compound can also be synthesized from 2,6-dichlorobenzaldehyde and methoxyethanol. 6CMB has been shown to react with anions such as Cl-, Br-, NO2-, SO3H, and PO3H2 to form organic carboxylates or sulfoxides. It has also been shown to be a byproduct of the reaction between chloral hydrate and potassium permanganate.</p>Formula:C8H7ClO2Purity:90%Color and Shape:PowderMolecular weight:170.59 g/molZ-Pro-Leu-Gly-OEt
CAS:<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>Formula:C23H33N3O6Purity:Min. 95%Molecular weight:447.52 g/molCRAMP (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C178H302N50O46Purity:Min. 95%Molecular weight:3,878.61 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Formula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/molH-D-Phe-Ala-OH
CAS:<p>3-Hydroxy-4-phenylbutyrate (H-D-Phe-Ala) is a fatty acid that is metabolized by the liver. It has been shown to be a potent inhibitor of the enzyme 3-hydroxyacyl coenzyme A dehydrogenase, which catalyzes the first step in fatty acid metabolism. H-D-Phe-Ala also inhibits the production of hormones such as insulin and glucagon and may be used to treat diabetes. This compound may also be useful for preventing or treating liver disease caused by alcohol abuse or other causes, due to its ability to inhibit enzymes that break down proteins in the cell. The addition of H-D-Phe-Ala has been shown to prevent formation of toxic metabolites in rats given an experimental drug, phenacetin, which can lead to kidney damage.</p>Formula:C12H16N2O3Purity:Min. 95%Molecular weight:236.27 g/molH-Asp-Ala-His-Lys-OH
CAS:<p>Please enquire for more information about H-Asp-Ala-His-Lys-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H31N7O7Purity:Min. 95%Molecular weight:469.49 g/molH-Ala-Pro-Ala-OH
CAS:<p>H-Ala-Pro-Ala-OH is a fluorescent amino acid residue that can be used to study the structures of proteins. This amino acid is derived from histidine, and its fluorescence intensity increases when it binds to tryptophan residues near the active site of an enzyme. H-Ala-Pro-Ala-OH has been used for the structural analysis of mutant enzymes that have been engineered to show differences in substrate binding sites. This molecule also has a fluorogenic substrate, which can be used as a replacement for traditional substrates in order to highlight specific regions of a protein or enzyme. The quantum theory was used to calculate the x-ray diffraction data, which were then analyzed using software programs such as MOLMOL and XPLOR. These datasets were then used to create molecular models of H-Ala-Pro-Ala-OH.</p>Formula:C11H19N3O4Purity:Min. 95%Molecular weight:257.29 g/molSubstance P (6-11)
CAS:<p>Substance P (6-11) H-Gln-Phe-Phe-Gly-Leu-Met-NH2 is a fatty acid with a molecular weight of 609.82 Da. It is an immune reaction and antinociceptive agent, which also has the ability to stimulate protein synthesis in the central nervous system. Substance P (6-11) H-Gln-Phe-Phe-Gly-Leu-Met-NH2 binds to neurokinin receptor type 1, which is involved in syncytial virus infection and rotarod test.</p>Formula:C36H52N8O7SPurity:Min. 95%Molecular weight:740.91 g/molε-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt
CAS:<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>Formula:C16H15N2NaO9SPurity:Min. 95%Molecular weight:434.35 g/molZ-His-Ala-OH
CAS:<p>Please enquire for more information about Z-His-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H20N4O5Purity:Min. 95%Molecular weight:360.36 g/molHIV-1 tat Protein (1-9)
CAS:<p>Tat is a protein from the human immunodeficiency virus type 1 (HIV-1) that is responsible for the regulation of viral gene expression. Tat binds to a cellular receptor, CD4, and enters the cell. The Tat protein forms a ternary complex with transcription factors and RNA polymerase II. This complex then binds to promoter regions of HIV genes and initiates transcription. Tat has been postulated to modulate immune functions such as chemokine production, T-cell activation, and macrophage activation. The HIV-1 tat Protein (1-9) H-Met-Asp-Pro-Val-Asp-Pro-Asn-Ile-Glu-OH has been shown to have an effect on the immune system by affecting chemokines and other immune functions.</p>Formula:C43H68N10O17SPurity:Min. 95%Molecular weight:1,029.12 g/molH-Ser-Gln-Asn-Phe-psi(CH2NH)Pro-Ile-Val-Gln-OH
CAS:<p>Please enquire for more information about H-Ser-Gln-Asn-Phe-psi(CH2NH)Pro-Ile-Val-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C42H67N11O12Purity:Min. 95%Molecular weight:918.05 g/mol(D-Arg2,Lys4)-Dermorphin (1-4) amide
CAS:<p>Dermorphin is a neuropeptide that has been shown to reduce cortisol levels in badgers and has been shown to have biological activity in vitro. Dermorphin also has a number of pharmacokinetic properties, including water solubility, lipid solubility, and oral bioavailability. The drug binds to δ receptors and inhibits the enzyme activities of rat liver microsomes. Dermorphin is used as an analgesic for bowel disease, such as inflammatory bowel disease or hypogaea. Dermorphin has antinociceptive properties (pain-relieving).</p>Formula:C30H45N9O5Purity:Min. 95%Molecular weight:611.74 g/molH-Asn-Glu-OH
CAS:<p>H-Asn-Glu-OH is a reversed-phase high-performance liquid chromatography (RP-HPLC) stationary phase that has been used for the analysis of glutamic acid. It has been shown to be resistant to hydrogen fluoride and other organic solvents, and does not contain any detectable impurities. H-Asn-Glu-OH is made up of amino acids, such as glutamic acid, which can be detected by reverse phase HPLC.</p>Formula:C9H15N3O6Purity:Min. 95%Molecular weight:261.23 g/molZ-Ala-His-OH
CAS:<p>Z-Ala-His-OH is a peptide consisting of three amino acids. It has been shown to have an optimal activity at pH 4.5, and can be recycled. Z-Ala-His-OH is synthesized by introducing the amino acid building blocks into a reaction system, where they are systematically introduced at different positions in order to produce the desired peptide sequence. Z-Ala-His-OH is an ionizable molecule that shows high affinity for the active site of its target enzyme. This property makes it useful in solvents with low dielectric constants, such as water or organic solvents with acidic properties. The kinetic behavior of this molecule has been studied systematically by measuring its rate of reaction in different solvents with different pH values and concentrations of reactants.END></p>Formula:C17H20N4O5Purity:Min. 95%Molecular weight:360.36 g/molMCH-Gene-Overprinted-Polypeptide-27 (rat)
CAS:<p>Please enquire for more information about MCH-Gene-Overprinted-Polypeptide-27 (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C145H227N39O40S4Purity:Min. 95%Molecular weight:3,284.86 g/molGRF (bovine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-Lys(Dnp)
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-Lys(Dnp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C51H67N11O21Purity:Min. 95%Molecular weight:1,170.14 g/mol(R)-(+)-3-Chloro-1-phenyl-1-propanol
CAS:<p>(R)-(+)-3-Chloro-1-phenyl-1-propanol is a substrate for the lactamase of bacteria. The immobilized lipase catalyzes the hydrolysis reaction in which the lactam ring is broken, yielding a propiophenone intermediate. This intermediate can be converted to (S)-(+)-3-chloro-1-phenylpropanol by treatment with an alcohol oxidase or by hydrolysis with hydrogen peroxide. The product has been shown to have antidepressant activity and may modulate the dry weight of bacteria. In vivo studies show that this compound has a high concentration in rats and mice, but it is not active in humans.</p>Formula:C9H11ClOPurity:Min. 95%Color and Shape:White To Yellow SolidMolecular weight:170.64 g/molH-Gly-Gly-Arg-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H20N6O4Purity:Min. 95%Molecular weight:288.3 g/mol

